DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and SEC14L4

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_016884276.1 Gene:SEC14L4 / 284904 HGNCID:20627 Length:465 Species:Homo sapiens


Alignment Length:404 Identity:134/404 - (33%)
Similarity:217/404 - (53%) Gaps:23/404 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PEISEEQ---RAILEKFRKQMDDAL--VGTHDDYFLVRWLRARKWNLEAAEKMLRASLKTRAMWN 65
            ||:....   |:...:||:.:.|.|  :...|||||:||||||.::|:.:|.|||..::.|...:
Human    62 PEVMRAPPTIRSSSAQFRENLQDLLPILPNADDYFLLRWLRARNFDLQKSEDMLRRHMEFRKQQD 126

  Fly    66 VDNIEKWDPPKALQEYLPYGLMGYDNEGSPVLVCPFANFDMWGMMHCVTRFEFQKYLVLLLERFM 130
            :|||..|.||:.:|.|...||.|||.||.||......:.|..|::...::.:..:..:.:.|..:
Human   127 LDNIVTWQPPEVIQLYDSGGLCGYDYEGCPVYFNIIGSLDPKGLLLSASKQDMIRKRIKVCELLL 191

  Fly   131 KIAYDQSQKHGWRARQLVVFFDMQDVNLKQYAWRPAAECVISTVKQYEANFPELLKMCYIINAPK 195
            .....|:||.|.:....::.|||:.::|| :.|:||.|.........|||:||.||...:|.|||
Human   192 HECELQTQKLGRKIEMALMVFDMEGLSLK-HLWKPAVEVYQQFFSILEANYPETLKNLIVIRAPK 255

  Fly   196 LFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKAFPKAWGGEMVDRNGDPQCKALM 260
            ||.||||:||.|:.|.|..||||..   |.|:::|...::....|..:||.|.|.:|:|:|...:
Human   256 LFPVAFNLVKSFMSEETRRKIVILG---DNWKQELTKFISPDQLPVEFGGTMTDPDGNPKCLTKI 317

  Fly   261 VWGGKLPEELYI-DQSSQQSDRDFVEAQVPKGDKLKLHFKVNVEEQKILSWEFRTFDYDIKFGIY 324
            .:||::|:..|: :|...|.:.   ...|.:|..|::..:: :....:|.|:|.:...||.||::
Human   318 NYGGEVPKSYYLCEQVRLQYEH---TRSVGRGSSLQVENEI-LFPGCVLRWQFASDGGDIGFGVF 378

  Fly   325 SVDDKTGEKRS-----EVPLGTVYSNEM-DEIGYISTRPNTTYTVVFDNSASYLRSKKLRYWVDL 383
             :..|.||::|     ||.....|:..| .|.|.::......|.:.|||:.|.:.:|||.|.|::
Human   379 -LKTKMGEQQSAREMTEVLPSQRYNAHMVPEDGSLTCLQAGVYVLRFDNTYSRMHAKKLSYTVEV 442

  Fly   384 ISEEEEGISELTTQ 397
            :..::  .||.|.|
Human   443 LLPDK--ASEETLQ 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 20/42 (48%)
SEC14 75..246 CDD:238099 59/170 (35%)
GOLD_2 303..381 CDD:290608 26/83 (31%)
SEC14L4XP_016884276.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151937
Domainoid 1 1.000 63 0.304 Domainoid score I10238
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68807
Inparanoid 1 1.050 224 1.000 Inparanoid score I3520
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52454
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 1 1.000 - - FOG0000197
OrthoInspector 1 1.000 - - otm41197
orthoMCL 1 0.900 - - OOG6_102488
Panther 1 1.100 - - O PTHR23324
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1090
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.