DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and Ttpa

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_037180.1 Gene:Ttpa / 25571 RGDID:3915 Length:278 Species:Rattus norvegicus


Alignment Length:275 Identity:59/275 - (21%)
Similarity:118/275 - (42%) Gaps:66/275 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GPL--PEISEE-------QRAILEKFRKQMDDALVGTHD---DYFLVRWLRARKWNLEAAEKMLR 55
            ||:  .:::|:       |..:.|..|:..::.:..|..   |.||:|:||||.::|:.|.::::
  Rat     7 GPVVGKQLNEQPDHSPLVQPGLAELRRRAQEEGVPETPQPLTDAFLLRFLRARDFDLDLAWRLMK 71

  Fly    56 ASLKTRAMWNVDNIEKW--DPPKALQEYLPYGLMGY------------DNEGSPVLVCPFANFDM 106
                        |..||  :.|:...:..|..::|.            |..||.||:...:.:| 
  Rat    72 ------------NYYKWRAECPELSADLHPRSILGLLKAGYHGVLRSRDPTGSRVLIYRISYWD- 123

  Fly   107 WGMMHCVTRFEFQKYLVLLLERFMKIAYDQSQKHGWRARQLVVFFDMQDVNLKQYAWR--PAAEC 169
               ....|.::.  :.|.|:...:.:...::|::|.:|     .||::       .|:  .|.:.
  Rat   124 ---PKVFTAYDV--FRVSLITSELIVQEVETQRNGVKA-----IFDLE-------GWQISHAFQI 171

  Fly   170 VISTVKQYEA----NFPELLKMCYIINAPKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQL 230
            ..|..|:..|    :||..::..::||.|.:|...|:::|.||.|....:|.::.   :.::..|
  Rat   172 TPSVAKKIAAVVTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKGRIHLHG---NNYKSSL 233

  Fly   231 FSHVNRKAFPKAWGG 245
            ..|. ....|..:||
  Rat   234 LQHF-PDILPLEYGG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 13/43 (30%)
SEC14 75..246 CDD:238099 39/189 (21%)
GOLD_2 303..381 CDD:290608
TtpaNP_037180.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 3/14 (21%)
CRAL_TRIO_N 25..73 CDD:215024 14/59 (24%)
CRAL_TRIO 99..248 CDD:395525 36/171 (21%)
Phosphatidylinositol 3,4-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 190..192 0/1 (0%)
Phosphatidylinositol 4,5-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 208..211 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.