DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and CG30339

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster


Alignment Length:342 Identity:75/342 - (21%)
Similarity:128/342 - (37%) Gaps:80/342 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LPEISEEQRAILEKFRKQM--DDALVGTHDDYFLVRWLRARKWNLEAAEKMLRASLKTRAMWNVD 67
            |.|:.|...|.|:..|..:  ...|....||.|||.:||..|::||          ||::     
  Fly    19 LNEVEERVPADLKALRDWLAKQPHLRARQDDQFLVGFLRGCKFSLE----------KTKS----- 68

  Fly    68 NIEKWDPPKALQEYLP--YGLMGYDNEGSPVLVCPFANF----DMWG------MMHCVTRFEFQK 120
               |.|....::..:|  :|....|...  :::|....:    ..||      .:....:|:.::
  Fly    69 ---KLDHFYTIKTLMPELFGKRLVDERN--LILCRSGTYVRLPKPWGTDGPRLQLTNYEKFDPKE 128

  Fly   121 YLVLLLERFMKIAYDQSQKH-------GWRARQLVVFFDMQDVNLKQYAWRPAAECVISTVKQY- 177
            :.:|.|.|:..:..:||.:.       |:     |...||..::|..     .|:...:.:|:. 
  Fly   129 FKLLDLFRYQTMITEQSIREDDHSNISGY-----VEIVDMAKMSLSF-----LAQLDFTLIKRMG 183

  Fly   178 ---EANFPELLKMCYIINAPKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKAF 239
               |...|..||..::||.||......|:.|..:......:..:||:     .|||...:.|:..
  Fly   184 IFAEKAQPTRLKGVHLINCPKEGVALLNLAKSLMPSKLQQRFHVYKN-----LEQLNEVIPREYL 243

  Fly   240 PKAWG---GEMVDRNGDPQCKALMVWGGKLPEELYIDQSSQQSDRDFVEAQVPKGDKLKLHFKVN 301
            |:.:|   |.:.|...:.:.|.|..       |.|..:.||..    |:.|:..|.      :||
  Fly   244 PEEYGGNNGRIADIQAEAEKKLLSY-------ESYFAEDSQYG----VDEQLRPGK------RVN 291

  Fly   302 VEEQKILSWEFRTFDYD 318
            .:........||..|.|
  Fly   292 ADSIFGAEGSFRKLDID 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 13/42 (31%)
SEC14 75..246 CDD:238099 37/196 (19%)
GOLD_2 303..381 CDD:290608 4/16 (25%)
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 16/59 (27%)
CRAL_TRIO 109..250 CDD:279044 33/155 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.