DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and Rlbp1

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001166954.1 Gene:Rlbp1 / 19771 MGIID:97930 Length:317 Species:Mus musculus


Alignment Length:256 Identity:57/256 - (22%)
Similarity:113/256 - (44%) Gaps:31/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LPEISEEQRAILEKFRKQMDDALVGTHDDYFLVRWLRARKWNLEAAEKMLRASLKTRAMWN--VD 67
            |.|:.:.|.|..|:....:.:. |...|..||:|::||||:::..|.::|:..:..|..:.  .|
Mouse    66 LQELVQAQAASGEELALAVAER-VQARDSAFLLRFIRARKFDVGRAYELLKGYVNFRLQYPELFD 129

  Fly    68 NIEKWDPPKALQEYLPYGLMGYDNEGSPVLVCPFANFDMWGMMHC--VTRFEFQKYLVLLLERFM 130
            ::........::...|..|...|..|..|::   .|.:.|   ||  ||..|..:....:||:.:
Mouse   130 SLSMEALRCTIEAGYPGVLSSRDKYGRVVML---FNIENW---HCEEVTFDEILQAYCFILEKLL 188

  Fly   131 KIAYDQSQKHGWRARQLVVFFDMQDVNLKQYAWRPAAECVISTVKQ----YEANFPELLKMCYII 191
            :  .:::|.:|:...:          |.|.:..:.||....|.:|:    .:.:||...|..:.|
Mouse   189 E--NEETQINGFCIVE----------NFKGFTMQQAAGLRPSDLKKMVDMLQDSFPARFKAIHFI 241

  Fly   192 NAPKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKAFPKAWGGEMVDRNG 252
            :.|..|:..:|:||.||......::.::...:|.:    |..::....|..:||.:...:|
Mouse   242 HQPWYFTTTYNVVKPFLKNKLLQRVFVHGDDLDGF----FQEIDENILPADFGGTLPKYDG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 12/40 (30%)
SEC14 75..246 CDD:238099 37/176 (21%)
GOLD_2 303..381 CDD:290608
Rlbp1NP_001166954.1 CRAL_TRIO_N 60..117 CDD:215024 16/51 (31%)
CRAL_TRIO 143..292 CDD:395525 37/170 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.