DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and R03A10.5

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_510554.2 Gene:R03A10.5 / 181634 WormBaseID:WBGene00010985 Length:382 Species:Caenorhabditis elegans


Alignment Length:388 Identity:76/388 - (19%)
Similarity:151/388 - (38%) Gaps:61/388 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DDALVGTHDDYFLVRWLRARK-WNLEAAEKMLRASLKTRAMWNVDNIEKWDPPKALQEYLPYGLM 87
            ||.....:.|:.::|||:... ..:|...:.::..|..||.||:|.:.|.:....:.::..||:.
 Worm    25 DDISEYYNTDFNILRWLQGHNTLPIEEIARKMKFHLNLRAAWNLDELHKKERNHPIHKHWKYGIT 89

  Fly    88 GYDNEGSPVLV----CPFANFDMWGMMHCVTRFEFQKYLVLLLERFMKIAYDQSQKHGWRARQLV 148
            |.......|:|    |  ...|..|||...:..|..:..::.||:.:....:...|.|.:|..|.
 Worm    90 GPSGHMDNVIVNIEQC--GKTDYTGMMETYSILEVMRARMVDLEQMLHHVMELEAKTGKQAWILY 152

  Fly   149 VFFDMQDVNLKQYAWRPAAECVISTVKQ----YEANFPELLKMCYIINAPKLFSVAFNIVKKFLD 209
            |    .|:...||. :...:.|..::|.    ...::.|::|....:..|...:..:.:|:..|.
 Worm   153 V----MDITGLQYN-KKLYDLVTGSMKSLADFMADHYVEMIKYFVPVCVPSFATALYVVVRPLLP 212

  Fly   210 ENTTSKIVIYKSGVDRWQEQLFSHVNRKAFPKAWGGEMVDRNGDPQCKALMVWGGKL------PE 268
            |.|..|:.:.  |...|::.:..:....:.|..|..|.            ..:||.:      |.
 Worm   213 EKTREKVRLI--GETNWRDDVLQYAIHSSLPSIWNNEN------------HTFGGFIELPIGYPT 263

  Fly   269 ELYIDQSSQQSDRDFVEAQVPKGDKLKLHFKVN-VEEQKILSWEFRTFDYDIKFGIYSVDDKTGE 332
            :.|....:....::.....||.|   |:|.... ::..:.|.|..|. :.:...|::..|:   |
 Worm   264 DGYYSAKNHSVVKNAQTVNVPYG---KIHVVTKFIKAGRKLRWWVRG-NRNFGLGVFHSDE---E 321

  Fly   333 KRSE-------------VPLGTVYSNEMDEIGYISTRPNTTYTVVFDNSASYLRSKKLRYWVD 382
            :.::             :|..|:...| ||   :..:.:..|.|...|..|:.|:.:::..|:
 Worm   322 QVADFFIAKQVSPCFPWMPGPTLVPME-DE---VIVKKDAYYHVWVSNEKSWWRTLEVQILVE 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 7/33 (21%)
SEC14 75..246 CDD:238099 35/178 (20%)
GOLD_2 303..381 CDD:290608 16/90 (18%)
R03A10.5NP_510554.2 SEC14 77..249 CDD:214706 36/192 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1090
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.