powered by:
Protein Alignment CG13893 and LOC110439320
DIOPT Version :9
Sequence 1: | NP_612042.3 |
Gene: | CG13893 / 38074 |
FlyBaseID: | FBgn0035146 |
Length: | 407 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_021330480.1 |
Gene: | LOC110439320 / 110439320 |
-ID: | - |
Length: | 230 |
Species: | Danio rerio |
Alignment Length: | 71 |
Identity: | 16/71 - (22%) |
Similarity: | 36/71 - (50%) |
Gaps: | 12/71 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 263 GGKLPEELYIDQSSQQSDRDFVE---------AQVPKGDKLKLHFKVNVEEQKILSWEFRTFDYD 318
||.:|:.|| :::::.:.:.|: |.|.||...::..:: .:...:::|:|.....|
Zfish 13 GGLVPKSLY--RTAEELENEEVKLWNETIYKSASVLKGAPHEVLIEI-TDVSSVITWDFDVCKGD 74
Fly 319 IKFGIY 324
:.|.||
Zfish 75 MIFNIY 80
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG13893 | NP_612042.3 |
CRAL_TRIO_N |
16..57 |
CDD:215024 |
|
SEC14 |
75..246 |
CDD:238099 |
|
GOLD_2 |
303..381 |
CDD:290608 |
6/22 (27%) |
LOC110439320 | XP_021330480.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170586531 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1133487at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.940 |
|
Return to query results.
Submit another query.