DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and LOC110439320

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_021330480.1 Gene:LOC110439320 / 110439320 -ID:- Length:230 Species:Danio rerio


Alignment Length:71 Identity:16/71 - (22%)
Similarity:36/71 - (50%) Gaps:12/71 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 GGKLPEELYIDQSSQQSDRDFVE---------AQVPKGDKLKLHFKVNVEEQKILSWEFRTFDYD 318
            ||.:|:.||  :::::.:.:.|:         |.|.||...::..:: .:...:::|:|.....|
Zfish    13 GGLVPKSLY--RTAEELENEEVKLWNETIYKSASVLKGAPHEVLIEI-TDVSSVITWDFDVCKGD 74

  Fly   319 IKFGIY 324
            :.|.||
Zfish    75 MIFNIY 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024
SEC14 75..246 CDD:238099
GOLD_2 303..381 CDD:290608 6/22 (27%)
LOC110439320XP_021330480.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586531
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.