DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13893 and LOC110437765

DIOPT Version :9

Sequence 1:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_021330443.1 Gene:LOC110437765 / 110437765 -ID:- Length:262 Species:Danio rerio


Alignment Length:196 Identity:39/196 - (19%)
Similarity:67/196 - (34%) Gaps:56/196 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 IEKWDPPKALQEYLPYGLM--GYDNEGSPVLVCP----FANFDMWGMMH------------CVTR 115
            ::|:..|..:.:| |:.|:  .||..   ...||    |...|:....|            |...
Zfish     2 VQKYQSPVRVYKY-PFELIMAAYDRR---FPTCPLIPMFVKSDIINESHSEDGAELFIERRCTVD 62

  Fly   116 FEFQKYLVLLLERFMKIAYDQSQKHGWRARQLVVFFDMQDVNLKQYAWRPAA--ECVISTVKQYE 178
            .|..:    ||:|...:.|             :.|.....:|.::......|  |...|.|..||
Zfish    63 VEAPR----LLKRIAGVDY-------------MYFIQKNSLNRRERTLHIEAYNESFSSRVNVYE 110

  Fly   179 ANFPELLKMCYIINAPK----LF--SVAFNIVKKFLDENTTSKIVI--YKSGVDRWQEQLFSHVN 235
                   ..||.::...    .|  |.:.:|...|..|:|..||.:  |.:.:.:.:|.:..|:.
Zfish   111 -------HCCYTVHPENEDWTCFEQSASMDIKSFFGFESTAEKIAMKQYATSIKKGKEIIEFHLK 168

  Fly   236 R 236
            :
Zfish   169 Q 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024
SEC14 75..246 CDD:238099 38/190 (20%)
GOLD_2 303..381 CDD:290608
LOC110437765XP_021330443.1 PRELI 17..173 CDD:309720 35/180 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.