Sequence 1: | NP_612042.3 | Gene: | CG13893 / 38074 | FlyBaseID: | FBgn0035146 | Length: | 407 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021330443.1 | Gene: | LOC110437765 / 110437765 | -ID: | - | Length: | 262 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 39/196 - (19%) |
---|---|---|---|
Similarity: | 67/196 - (34%) | Gaps: | 56/196 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 69 IEKWDPPKALQEYLPYGLM--GYDNEGSPVLVCP----FANFDMWGMMH------------CVTR 115
Fly 116 FEFQKYLVLLLERFMKIAYDQSQKHGWRARQLVVFFDMQDVNLKQYAWRPAA--ECVISTVKQYE 178
Fly 179 ANFPELLKMCYIINAPK----LF--SVAFNIVKKFLDENTTSKIVI--YKSGVDRWQEQLFSHVN 235
Fly 236 R 236 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13893 | NP_612042.3 | CRAL_TRIO_N | 16..57 | CDD:215024 | |
SEC14 | 75..246 | CDD:238099 | 38/190 (20%) | ||
GOLD_2 | 303..381 | CDD:290608 | |||
LOC110437765 | XP_021330443.1 | PRELI | 17..173 | CDD:309720 | 35/180 (19%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1133487at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |