DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kah and CRZ1

DIOPT Version :9

Sequence 1:NP_612040.1 Gene:Kah / 38072 FlyBaseID:FBgn0035144 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_014371.1 Gene:CRZ1 / 855704 SGDID:S000004972 Length:678 Species:Saccharomyces cerevisiae


Alignment Length:272 Identity:64/272 - (23%)
Similarity:114/272 - (41%) Gaps:69/272 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKDQQATPIPEELYNLTQLAEVTLSVGPLVTDEVKPLPLYASSDDDSNYYSHKVFDRRKLRRCT 65
            ::.|::|..|......|.::|::              ||   ||::|:|   .:.:|        
Yeast   428 ISPDEKAKSISANREKLLEMADL--------------LP---SSENDNN---RERYD-------- 464

  Fly    66 ISDSNSCASSSSSSTSSRQSSEDHLGLQGHSSVHHHHGEQGEI-----LNSTS----LLEDEHIC 121
             :||.:..::.:||..:..::.::| |.....:     |.|.:     |:.||    :|.|....
Yeast   465 -NDSKTSYNTINSSNFNEDNNNNNL-LTSKPKI-----ESGIVNIKNELDDTSKDLGILLDIDSL 522

  Fly   122 PECGKKYSTSSNLARHRQTHRSIMDKKARHCPYCEKVYVSMPAYSMHVRTHNQ----GCECQFCG 182
            .:..:|....::.......:.:...||..:....:.|            |:|:    ...|..||
Yeast   523 GQFEQKVGFKNDDNHENNDNGTFSVKKNDNLEKLDSV------------TNNRKNPANFACDVCG 575

  Fly   183 KRFSRPWLLQGHIRTHTGEKPFKCGVCEKAFADKSNLRAHIQTHSNTKPHTCA---------RCG 238
            |:|:||:.|:.|:||||.|:||.|.:|.||||.:.:.:.|...|:..|.:.|.         .||
Yeast   576 KKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCG 640

  Fly   239 KAFALKSYLYKH 250
            |.||....|.:|
Yeast   641 KKFARSDALGRH 652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KahNP_612040.1 zf-C2H2 119..141 CDD:278523 1/21 (5%)
C2H2 Zn finger 121..141 CDD:275368 1/19 (5%)
zf-C2H2 176..198 CDD:278523 10/21 (48%)
C2H2 Zn finger 178..198 CDD:275368 10/19 (53%)
zf-H2C2_2 191..214 CDD:290200 13/22 (59%)
zf-C2H2 204..226 CDD:278523 8/21 (38%)
C2H2 Zn finger 206..226 CDD:275368 7/19 (37%)
zf-H2C2_2 218..242 CDD:290200 7/32 (22%)
C2H2 Zn finger 234..250 CDD:275368 7/24 (29%)
CRZ1NP_014371.1 COG5048 139..617 CDD:227381 54/235 (23%)
C2H2 Zn finger 571..591 CDD:275368 10/19 (53%)
C2H2 Zn finger 599..619 CDD:275368 7/19 (37%)
C2H2 Zn finger 627..655 CDD:275368 8/26 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.