DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kah and snai1b

DIOPT Version :9

Sequence 1:NP_612040.1 Gene:Kah / 38072 FlyBaseID:FBgn0035144 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_571064.2 Gene:snai1b / 792194 ZFINID:ZDB-GENE-980526-514 Length:256 Species:Danio rerio


Alignment Length:211 Identity:87/211 - (41%)
Similarity:110/211 - (52%) Gaps:41/211 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 ISDSNSC------ASSSSSSTSSRQSSEDHLGLQGHSSVHHHHGEQGEILNS---TSLLEDEHIC 121
            :|.|.||      .||.|||:||                    ||:.:...|   :....|...|
Zfish    62 VSSSVSCPPAPLDLSSPSSSSSS--------------------GEEDDCRTSDPPSPDPSDRFQC 106

  Fly   122 PECGKKYSTSSNLARHRQTHRSIMD------------KKARHCPYCEKVYVSMPAYSMHVRTHNQ 174
            ..|||..|:.:.|:||:..|.|..|            :.|.||.:|.|.|.|:.|..||:|:|..
Zfish   107 AHCGKSCSSPAALSRHQLAHCSPQDGISGATSSLTSSRAAFHCKHCPKEYNSLGALKMHIRSHTL 171

  Fly   175 GCECQFCGKRFSRPWLLQGHIRTHTGEKPFKCGVCEKAFADKSNLRAHIQTHSNTKPHTCARCGK 239
            .|.|..|||.|||||||:|||||||||:||.|..|.:||||:||||||:||||..|.:.|..|.:
Zfish   172 PCVCSTCGKAFSRPWLLRGHIRTHTGERPFSCPHCNRAFADRSNLRAHLQTHSEVKKYQCGSCSR 236

  Fly   240 AFALKSYLYKHEESSC 255
            .|:..|.|:||..|.|
Zfish   237 TFSRMSLLHKHTLSGC 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KahNP_612040.1 zf-C2H2 119..141 CDD:278523 8/21 (38%)
C2H2 Zn finger 121..141 CDD:275368 8/19 (42%)
zf-C2H2 176..198 CDD:278523 16/21 (76%)
C2H2 Zn finger 178..198 CDD:275368 15/19 (79%)
zf-H2C2_2 191..214 CDD:290200 15/22 (68%)
zf-C2H2 204..226 CDD:278523 14/21 (67%)
C2H2 Zn finger 206..226 CDD:275368 13/19 (68%)
zf-H2C2_2 218..242 CDD:290200 12/23 (52%)
C2H2 Zn finger 234..250 CDD:275368 5/15 (33%)
snai1bNP_571064.2 C2H2 Zn finger 149..169 CDD:275368 9/19 (47%)
C2H2 Zn finger 175..195 CDD:275368 15/19 (79%)
zf-H2C2_2 188..211 CDD:316026 15/22 (68%)
zf-C2H2 201..223 CDD:306579 14/21 (67%)
C2H2 Zn finger 203..223 CDD:275368 13/19 (68%)
C2H2 Zn finger 231..247 CDD:275368 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.