DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kah and snai3

DIOPT Version :9

Sequence 1:NP_612040.1 Gene:Kah / 38072 FlyBaseID:FBgn0035144 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001070853.1 Gene:snai3 / 567724 ZFINID:ZDB-GENE-061013-757 Length:283 Species:Danio rerio


Alignment Length:256 Identity:99/256 - (38%)
Similarity:125/256 - (48%) Gaps:46/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKDQQATPIPEELYNLTQLAEVTLSVGPLVTDEVKP-LPLYASSDDDSNYYSHKVFDRRKLRRC 64
            |.....:.||.:.:..||.......|  ||  .:::| |.:...:|..|...||:          
Zfish    69 MPPQHPSLPIDDPILGLTYPLPAPSS--PL--RDMRPALSMLEHTDPSSLQLSHR---------- 119

  Fly    65 TISDSNSCASSSSSSTSSRQSSEDHLGLQGHSSVHHHHGEQGEILNSTSLLEDEHICPECGKKYS 129
               |.:.....|....::..:|::|                          .||  |.:|.|.|.
Zfish   120 ---DLHEKVPVSPLGLTTTGNSQEH--------------------------SDE--CFDCQKAYL 153

  Fly   130 TSSNLARHRQTHRSIMDKKARHCPYCEKVYVSMPAYSMHVRTHNQGCECQFCGKRFSRPWLLQGH 194
            :.||||..||.|......|...|.||||.|||:.|..||:|||...|.|:.|||.||||||||||
Zfish   154 SFSNLANQRQVHCQWPCHKYFTCKYCEKEYVSLGALKMHIRTHTLPCVCKLCGKAFSRPWLLQGH 218

  Fly   195 IRTHTGEKPFKCGVCEKAFADKSNLRAHIQTHSNTKPHTCARCGKAFALKSYLYKHEESSC 255
            ||||||||||.|..|.:||||:||||||:||||..|.:.|..|.|.|:..|.|.||||:.|
Zfish   219 IRTHTGEKPFTCPHCSRAFADRSNLRAHLQTHSEIKKYQCRNCFKTFSRISLLTKHEEAGC 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KahNP_612040.1 zf-C2H2 119..141 CDD:278523 10/21 (48%)
C2H2 Zn finger 121..141 CDD:275368 10/19 (53%)
zf-C2H2 176..198 CDD:278523 17/21 (81%)
C2H2 Zn finger 178..198 CDD:275368 16/19 (84%)
zf-H2C2_2 191..214 CDD:290200 17/22 (77%)
zf-C2H2 204..226 CDD:278523 14/21 (67%)
C2H2 Zn finger 206..226 CDD:275368 13/19 (68%)
zf-H2C2_2 218..242 CDD:290200 13/23 (57%)
C2H2 Zn finger 234..250 CDD:275368 6/15 (40%)
snai3NP_001070853.1 C2H2 Zn finger 176..196 CDD:275368 12/19 (63%)
C2H2 Zn finger 202..222 CDD:275368 16/19 (84%)
zf-H2C2_2 215..238 CDD:290200 17/22 (77%)
zf-C2H2 228..250 CDD:278523 14/21 (67%)
C2H2 Zn finger 230..250 CDD:275368 13/19 (68%)
C2H2 Zn finger 258..274 CDD:275368 6/15 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.