DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kah and wdn

DIOPT Version :9

Sequence 1:NP_612040.1 Gene:Kah / 38072 FlyBaseID:FBgn0035144 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_476900.1 Gene:wdn / 43398 FlyBaseID:FBgn0005642 Length:869 Species:Drosophila melanogaster


Alignment Length:520 Identity:106/520 - (20%)
Similarity:182/520 - (35%) Gaps:153/520 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PEELYNLTQLAEVTL---------------------SVGPLVTDEVKPLPLYASSDDDSNYYSHK 54
            ||::....::.|..|                     |:.|....|.|||.:              
  Fly   213 PEQVVTKVEVCESELLPPSFTIFQQAKSAESVADAASMPPPAASETKPLEV-------------- 263

  Fly    55 VFDRRKLRRCTISDSNSCASSSSSSTSSRQSSEDHLGLQGHSSVHHHHGEQGEILNSTSLLEDEH 119
              |...|.:|.  |.|.....:....:..:::...|.|                         .:
  Fly   264 --DPAPLHKCL--DCNGLLLETPDEVAKHEAAAHRLRL-------------------------TY 299

  Fly   120 ICPECGKKYSTSSNLARHRQTHRSIMDKKA-RHCPYCEKVYVSMPAYSMHVRTH--NQGCECQFC 181
            .|.||.:::...:.|.:|.:|||:...|.. :.||.|.|. :.:.:..||.:.|  |:..:|..|
  Fly   300 RCSECQREFELLAGLKKHLKTHRTEGRKDTWKKCPDCGKC-LKLGSMWMHRKIHSDNKKYQCDIC 363

  Fly   182 GKRFSRPWLLQGHIRTHTGEKPFKCGVCEKAFADKSNLRAHIQTHSNTKPHTCARCGKAFALKSY 246
            |::|.:...|..|.|.|:.|||::|..|:|.|.::|:|:.|.:.|:.|:.:.|.:|||.:..:..
  Fly   364 GQKFVQKINLTHHARIHSSEKPYECPECQKRFQERSHLQRHQKYHAQTRSYRCEKCGKMYKTERC 428

  Fly   247 LYKHE--------------ESSCMKNRGGVPGSGAASGNRP-------------PS----SPKRQ 280
            |..|.              :.|.:.|......|...:|.||             |:    :.:|.
  Fly   429 LKVHNLVHLEQRPFACTVCDKSFISNSKLKQHSNIHTGMRPFKCNYCPRDFTNFPNWLKHTRRRH 493

  Fly   281 QAEVTSG---------------TISALAPGSPAAAVCAASDS-------------AKSTLAN--- 314
            :.:..:|               |..|....:.|||..|||.:             ||:.|.:   
  Fly   494 KVDHKTGEHLENIPSYCSKKSTTNKAQKAAAAAAAAAAASSAVNPNELSASSELKAKANLTSTAA 558

  Fly   315 ----KLLQKEKDRRQAAMAFQG--FPAGPEVTAYSHATSAQEEYEKFKRINVIQPKVMPHRVPSL 373
                |..:|:|..:||.:|..|  .|||..:........||:..::...:      ::|...|:.
  Fly   559 PAPAKQARKKKQPQQATLAALGITLPAGTALQQVHPVPLAQQHQQELTTV------LVPLAPPAP 617

  Fly   374 YQDLLPNRHVPLALPLAMPYHFQGQATSTGQSDPTSVQEQPVDFSPKNNFTHSAKTSPFELTGNY 438
            .|.........||     |...|.:.....|..|.....:|:...|:      .|..|.:..|.:
  Fly   618 KQTKAKRERKQLA-----PKQLQQKPQLLQQGQPQQSSLEPIPAVPQ------IKKEPVQTQGPF 671

  Fly   439  438
              Fly   672  671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KahNP_612040.1 zf-C2H2 119..141 CDD:278523 5/21 (24%)
C2H2 Zn finger 121..141 CDD:275368 5/19 (26%)
zf-C2H2 176..198 CDD:278523 7/21 (33%)
C2H2 Zn finger 178..198 CDD:275368 7/19 (37%)
zf-H2C2_2 191..214 CDD:290200 10/22 (45%)
zf-C2H2 204..226 CDD:278523 7/21 (33%)
C2H2 Zn finger 206..226 CDD:275368 7/19 (37%)
zf-H2C2_2 218..242 CDD:290200 8/23 (35%)
C2H2 Zn finger 234..250 CDD:275368 5/15 (33%)
wdnNP_476900.1 C2H2 Zn finger 301..321 CDD:275368 5/19 (26%)
RPB9 333..425 CDD:224510 32/92 (35%)
C2H2 Zn finger 333..352 CDD:275368 6/19 (32%)
zf-H2C2_2 344..369 CDD:290200 8/24 (33%)
zf-C2H2 358..380 CDD:278523 7/21 (33%)
C2H2 Zn finger 360..380 CDD:275368 7/19 (37%)
zf-H2C2_2 372..395 CDD:290200 10/22 (45%)
zf-C2H2 386..408 CDD:278523 7/21 (33%)
C2H2 Zn finger 388..436 CDD:275368 15/47 (32%)
zf-H2C2_2 400..425 CDD:290200 8/24 (33%)
C2H2 Zn finger 416..433 CDD:275368 5/16 (31%)
zf-H2C2_2 429..453 CDD:290200 3/23 (13%)
C2H2 Zn finger 444..464 CDD:275368 3/19 (16%)
zf-H2C2_2 457..481 CDD:290200 4/23 (17%)
C2H2 Zn finger 472..493 CDD:275368 1/20 (5%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457084
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.