| Sequence 1: | NP_612040.1 | Gene: | Kah / 38072 | FlyBaseID: | FBgn0035144 | Length: | 442 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_650728.1 | Gene: | CG7691 / 42228 | FlyBaseID: | FBgn0038626 | Length: | 283 | Species: | Drosophila melanogaster |
| Alignment Length: | 205 | Identity: | 67/205 - (32%) |
|---|---|---|---|
| Similarity: | 87/205 - (42%) | Gaps: | 45/205 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 83 RQSSEDHLGLQ-------GHSSVHHH-------HGEQGEILNSTSLLEDEHICPECGKKYSTSSN 133
Fly 134 LARHRQTHRSIMDKKARHCPYCEKVYV-------------SMPAYSMHVRTHNQGCECQFCGKRF 185
Fly 186 SRPWLLQGHIRTHTGEKPFKC--GVCEKAFADKSNLRAHIQTHSNTK-PHTCARCGKAFALKSYL 247
Fly 248 YKHEESSCMK 257 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Kah | NP_612040.1 | zf-C2H2 | 119..141 | CDD:278523 | 4/21 (19%) |
| C2H2 Zn finger | 121..141 | CDD:275368 | 4/19 (21%) | ||
| zf-C2H2 | 176..198 | CDD:278523 | 9/21 (43%) | ||
| C2H2 Zn finger | 178..198 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 191..214 | CDD:290200 | 16/24 (67%) | ||
| zf-C2H2 | 204..226 | CDD:278523 | 13/23 (57%) | ||
| C2H2 Zn finger | 206..226 | CDD:275368 | 12/21 (57%) | ||
| zf-H2C2_2 | 218..242 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 234..250 | CDD:275368 | 8/15 (53%) | ||
| CG7691 | NP_650728.1 | COG5048 | 188..>271 | CDD:227381 | 41/83 (49%) |
| C2H2 Zn finger | 191..211 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 203..229 | CDD:290200 | 16/25 (64%) | ||
| C2H2 Zn finger | 219..244 | CDD:275368 | 13/24 (54%) | ||
| C2H2 Zn finger | 250..266 | CDD:275368 | 8/15 (53%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG2462 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||