DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kah and CG6813

DIOPT Version :9

Sequence 1:NP_612040.1 Gene:Kah / 38072 FlyBaseID:FBgn0035144 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster


Alignment Length:145 Identity:46/145 - (31%)
Similarity:68/145 - (46%) Gaps:7/145 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 HICPECGKKYSTSSNLARHRQTHRSIMDKKARHCPY--CEKVYVSMPAYSMHVRTH--NQGCECQ 179
            ::||:||:..:..||...|...|..|   |..||.:  ||:.:.:....:.|.|.|  .|...|.
  Fly   142 YVCPDCGRIINNKSNFQEHTLRHTGI---KNFHCVFLNCERSFATRKELTSHTRIHTGEQPYVCV 203

  Fly   180 FCGKRFSRPWLLQGHIRTHTGEKPFKCGVCEKAFADKSNLRAHIQTHSNTKPHTCARCGKAFALK 244
            :|.:|||.....|.|.|.|..|:.::|..|:|:|.....||.|...|.:.:.|.|..|.|.|...
  Fly   204 YCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMIHVDARNHYCYVCQKHFKRI 268

  Fly   245 SYLYKHEESSCMKNR 259
            |:|..|..|:..|.:
  Fly   269 SHLMTHLSSNIHKRK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KahNP_612040.1 zf-C2H2 119..141 CDD:278523 7/21 (33%)
C2H2 Zn finger 121..141 CDD:275368 7/19 (37%)
zf-C2H2 176..198 CDD:278523 8/21 (38%)
C2H2 Zn finger 178..198 CDD:275368 8/19 (42%)
zf-H2C2_2 191..214 CDD:290200 8/22 (36%)
zf-C2H2 204..226 CDD:278523 7/21 (33%)
C2H2 Zn finger 206..226 CDD:275368 7/19 (37%)
zf-H2C2_2 218..242 CDD:290200 8/23 (35%)
C2H2 Zn finger 234..250 CDD:275368 6/15 (40%)
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071
C2H2 Zn finger 144..164 CDD:275368 7/19 (37%)
C2H2 Zn finger 172..194 CDD:275368 5/21 (24%)
zf-H2C2_2 186..211 CDD:290200 8/24 (33%)
UFD2 <256..>294 CDD:227443 10/28 (36%)
C2H2 Zn finger 258..280 CDD:275368 8/21 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457119
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.