DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kah and CG4820

DIOPT Version :9

Sequence 1:NP_612040.1 Gene:Kah / 38072 FlyBaseID:FBgn0035144 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001097748.1 Gene:CG4820 / 41344 FlyBaseID:FBgn0037876 Length:362 Species:Drosophila melanogaster


Alignment Length:260 Identity:60/260 - (23%)
Similarity:93/260 - (35%) Gaps:81/260 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKDQQATPIPEELYNLTQLAEVTLSVGPLVTDEVKPLPL-YASSDDDSNYYSHKVFDRRKLRRC 64
            |.:|.|| |.||     .|| |..||.|....:::.|||. |..:..:....:::...||     
  Fly   125 MEEDPQA-PYPE-----NQL-EQALSYGNAPGEDILPLPEDYGEAQTEVATTTNEPAQRR----- 177

  Fly    65 TISDSNSCASSSSSSTSSRQSSEDHLGLQGHSSVHHHHGEQGEILNSTSLLEDEHICPECGKKYS 129
                         |..:::..|:.|....|...:|            ..:::|            
  Fly   178 -------------SKNTAKIKSKKHTMRVGRKLIH------------VKVIDD------------ 205

  Fly   130 TSSNLARHRQTHRSIMDKKARHCPYCEKVYVSMPAYSMHVRTHNQGCECQFCGKRFSRPWLLQGH 194
                    :|..| |:|   |:.|..:.                  |.|:.||::|.....|..|
  Fly   206 --------KQPKR-IVD---RNGPSAKP------------------CICEHCGRQFKDTSNLHVH 240

  Fly   195 IRTHTGEKPFKCGVCEKAFADKSNLRAHIQTHSNTKPHTCARCGKAFALKSYLYKHEESSCMKNR 259
            :..|||.|||:|..|.:.......||.|...|:. .|:.|..||..::..|...:||..:|.|.|
  Fly   241 LLRHTGTKPFECDQCHQKCYTLHLLRRHQLKHTE-GPYACTFCGLEYSTNSSRVRHEREACKKGR 304

  Fly   260  259
              Fly   305  304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KahNP_612040.1 zf-C2H2 119..141 CDD:278523 1/21 (5%)
C2H2 Zn finger 121..141 CDD:275368 1/19 (5%)
zf-C2H2 176..198 CDD:278523 7/21 (33%)
C2H2 Zn finger 178..198 CDD:275368 6/19 (32%)
zf-H2C2_2 191..214 CDD:290200 10/22 (45%)
zf-C2H2 204..226 CDD:278523 6/21 (29%)
C2H2 Zn finger 206..226 CDD:275368 5/19 (26%)
zf-H2C2_2 218..242 CDD:290200 8/23 (35%)
C2H2 Zn finger 234..250 CDD:275368 4/15 (27%)
CG4820NP_001097748.1 zf-AD 4..75 CDD:285071
C2H2 Zn finger 224..244 CDD:275368 6/19 (32%)
C2H2 Zn finger 252..272 CDD:275368 5/19 (26%)
C2H2 Zn finger 279..297 CDD:275368 5/17 (29%)
C2H2 Zn finger 322..339 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457093
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.