DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kah and ranshi

DIOPT Version :9

Sequence 1:NP_612040.1 Gene:Kah / 38072 FlyBaseID:FBgn0035144 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster


Alignment Length:173 Identity:51/173 - (29%)
Similarity:77/173 - (44%) Gaps:32/173 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 EILNSTSLLEDEHICP----------------------ECGKKYSTSSNLARHRQTHRSIMD-KK 148
            :|||.:.:.|||   |                      :..::..:.|...:.|:..|:..| .:
  Fly   133 DILNESKINEDE---PNNEDDIDYSEMDYLIYESDTEVDAKQELKSDSENPKKRRNRRNPRDSNR 194

  Fly   149 ARHCPYCEKVYVSMPAYSMHVRTHNQGCE--CQFCGKRFSRPWLLQGHIRTHTGEKPFKCGVCEK 211
            ...|..|........::.:|.:.|....|  |:||..||..|..|:.|||.|||||||||..|.:
  Fly   195 TFFCEECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSR 259

  Fly   212 AFADKSNLRAHIQTHSNTKPHTCARCGKAFA----LKSYLYKH 250
            :|:|.|....|.:||:|.:|..|..|..||.    ||:::..|
  Fly   260 SFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVH 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KahNP_612040.1 zf-C2H2 119..141 CDD:278523 3/43 (7%)
C2H2 Zn finger 121..141 CDD:275368 3/41 (7%)
zf-C2H2 176..198 CDD:278523 11/23 (48%)
C2H2 Zn finger 178..198 CDD:275368 10/19 (53%)
zf-H2C2_2 191..214 CDD:290200 14/22 (64%)
zf-C2H2 204..226 CDD:278523 8/21 (38%)
C2H2 Zn finger 206..226 CDD:275368 6/19 (32%)
zf-H2C2_2 218..242 CDD:290200 8/23 (35%)
C2H2 Zn finger 234..250 CDD:275368 6/19 (32%)
ranshiNP_649824.1 zf-AD 5..77 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 3/19 (16%)
COG5048 222..>276 CDD:227381 27/53 (51%)
C2H2 Zn finger 226..246 CDD:275368 10/19 (53%)
zf-H2C2_2 238..262 CDD:290200 14/23 (61%)
C2H2 Zn finger 254..274 CDD:275368 6/19 (32%)
zf-H2C2_2 269..291 CDD:290200 9/21 (43%)
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
zf-H2C2_2 295..319 CDD:290200 3/8 (38%)
C2H2 Zn finger 310..328 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.