DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kah and nom

DIOPT Version :9

Sequence 1:NP_612040.1 Gene:Kah / 38072 FlyBaseID:FBgn0035144 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster


Alignment Length:257 Identity:62/257 - (24%)
Similarity:102/257 - (39%) Gaps:42/257 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TKDQQATP-IPEELYNLTQLAEVTLSVGPLVTDEVKPLPLYASSDDDSNYYSHKVFDRRKLRRCT 65
            ||.::..| :|.|:.::....|...|.|..|..:....|:..|::.|:                |
  Fly   105 TKRRRGRPRMPLEIVDIVVTNESKASAGESVGGDEFDQPVEISNEPDA----------------T 153

  Fly    66 ISDSNSCASSSSSSTSSRQSSEDHLGLQGHSSVHHHHGEQGEILNSTSLLEDEHICPECGKKYST 130
            .||.|.                :.:.|.....:...|.     |.:..:    |.|..||...:.
  Fly   154 DSDVNL----------------EEIDLPDEDGLESDHD-----LPNVQI----HKCDTCGIIKNN 193

  Fly   131 SSNLARHRQTHRSIMDKKARHCPYCEKVYVSMPAYSMHVRTHNQGCECQFCGKRFSRPWLLQGHI 195
            .|:|.||:..|..|.....:.||....|...:.|:::...|......|::|.:|:......:.|.
  Fly   194 KSSLVRHQFEHNGIRPYPCKECPKTFLVASELKAHNLTHHTLEPPFACRYCDRRYFSVVGRKKHE 258

  Fly   196 RTHTGEKPFKCGVCEKAFADKSNLRAHIQTHSNTKPHTCARCGKAFALKSYLYKHEESSCMK 257
            |.||.|:||.|..|.|||.....|:||:..|...:.::|..|.::|:||.:|..|..|:..|
  Fly   259 RVHTNERPFVCDQCGKAFTRTCILKAHMAVHQVVRKYSCDVCDRSFSLKKHLATHFISNTHK 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KahNP_612040.1 zf-C2H2 119..141 CDD:278523 8/21 (38%)
C2H2 Zn finger 121..141 CDD:275368 7/19 (37%)
zf-C2H2 176..198 CDD:278523 5/21 (24%)
C2H2 Zn finger 178..198 CDD:275368 5/19 (26%)
zf-H2C2_2 191..214 CDD:290200 11/22 (50%)
zf-C2H2 204..226 CDD:278523 9/21 (43%)
C2H2 Zn finger 206..226 CDD:275368 8/19 (42%)
zf-H2C2_2 218..242 CDD:290200 6/23 (26%)
C2H2 Zn finger 234..250 CDD:275368 6/15 (40%)
nomNP_001262384.1 zf-AD 5..76 CDD:214871
C2H2 Zn finger 184..204 CDD:275368 7/19 (37%)
C2H2 Zn finger 212..261 CDD:275368 10/48 (21%)
zf-H2C2_2 255..278 CDD:290200 12/22 (55%)
C2H2 Zn finger 269..289 CDD:275368 8/19 (42%)
zf-H2C2_2 282..305 CDD:290200 6/22 (27%)
C2H2 Zn finger 297..313 CDD:275368 6/15 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.