DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kah and D19B

DIOPT Version :9

Sequence 1:NP_612040.1 Gene:Kah / 38072 FlyBaseID:FBgn0035144 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_477297.1 Gene:D19B / 38717 FlyBaseID:FBgn0022699 Length:774 Species:Drosophila melanogaster


Alignment Length:424 Identity:90/424 - (21%)
Similarity:121/424 - (28%) Gaps:193/424 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LQGHSSVHHHHGEQ--------GEILNSTSLLED---------EHICPECGKKYSTSSNLARHRQ 139
            |:.|  ::.|.||:        |:.....|:|.|         .|:||.||...:|.....:|..
  Fly   362 LKKH--MYKHTGEELPFACEICGKRFPINSVLRDHLLRHAGIKNHVCPYCGVGKTTRQEWNKHIL 424

  Fly   140 THRSIMDKK----------------ARH------------CPYCEKVYVSMPAYSMHVRTH--NQ 174
            ||..  :||                |.|            |.||.|.:....|..:|.|:|  .:
  Fly   425 THTK--EKKYECRQCDHASHNKQALANHVKVVHEKRKDFACQYCGKTFGKSHACKIHERSHTGEK 487

  Fly   175 GCECQFCGKRFSRPWLLQGHIRTH-----------------------TGEKP------------- 203
            .|||:.|||.|.....|..|::||                       |..||             
  Fly   488 CCECKICGKVFLFEKGLTKHLKTHEKRDLPKTQGTNALMGDGASGSSTIAKPSPHLRGRVERVDI 552

  Fly   204 ------------------------------------------------------------FKCGV 208
                                                                        |.|..
  Fly   553 AQLAGTVANPIPSVNLPSWSPQVNFTKKEGQHICPDCGKGFNHVSNMKLHYKVVHQKVKDFCCRF 617

  Fly   209 CEKAFADKSNLRAHIQTHSNTKPHTCARCGKAFALKSYLYKHEESSCMKNRGGVPGSGAASGNRP 273
            |.|.||.|..||.|...|:..||:.|..|||.|..:..|..|     ||.....|        ||
  Fly   618 CPKRFAKKQYLRHHEYIHTGEKPYECKVCGKHFRQEQVLKTH-----MKVHDKPP--------RP 669

  Fly   274 PSSPKRQQAEVTSGTISALAPGSPAAAVCAASDSAKSTLANKLLQKEKDRRQAAMAFQGFPAGPE 338
            |..||.              |..|         .|:|:.|.|..|.:...:....|.:...|..|
  Fly   670 PGKPKE--------------PAGP---------KAESSTAVKRQQPKNFEQYQDPAAERAAATAE 711

  Fly   339 VTAY-----SHATSAQEEYEK-----FKRINVIQ 362
            :.||     .....|:.|..|     |:::|.:|
  Fly   712 LLAYQIEENEAKRKAEAELRKIQEAAFEQLNKLQ 745

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KahNP_612040.1 zf-C2H2 119..141 CDD:278523 7/21 (33%)
C2H2 Zn finger 121..141 CDD:275368 6/19 (32%)
zf-C2H2 176..198 CDD:278523 9/21 (43%)
C2H2 Zn finger 178..198 CDD:275368 7/19 (37%)
zf-H2C2_2 191..214 CDD:290200 11/118 (9%)
zf-C2H2 204..226 CDD:278523 10/21 (48%)
C2H2 Zn finger 206..226 CDD:275368 9/19 (47%)
zf-H2C2_2 218..242 CDD:290200 10/23 (43%)
C2H2 Zn finger 234..250 CDD:275368 6/15 (40%)
D19BNP_477297.1 zf-AD 12..83 CDD:214871
C2H2 Zn finger 255..275 CDD:275368
C2H2 Zn finger 283..335 CDD:275368
C2H2 Zn finger 318..338 CDD:275368
COG5048 <347..512 CDD:227381 40/153 (26%)
C2H2 Zn finger 349..369 CDD:275368 2/8 (25%)
C2H2 Zn finger 378..398 CDD:275368 4/19 (21%)
C2H2 Zn finger 406..426 CDD:275368 6/19 (32%)
C2H2 Zn finger 434..455 CDD:275368 2/20 (10%)
C2H2 Zn finger 463..483 CDD:275368 7/19 (37%)
C2H2 Zn finger 491..511 CDD:275368 7/19 (37%)
C2H2 Zn finger 586..607 CDD:275368 0/20 (0%)
C2H2 Zn finger 615..635 CDD:275368 9/19 (47%)
zf-H2C2_2 627..652 CDD:290200 11/24 (46%)
C2H2 Zn finger 643..663 CDD:275368 9/24 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.