DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kah and CG11906

DIOPT Version :9

Sequence 1:NP_612040.1 Gene:Kah / 38072 FlyBaseID:FBgn0035144 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_611402.2 Gene:CG11906 / 37209 FlyBaseID:FBgn0034425 Length:634 Species:Drosophila melanogaster


Alignment Length:238 Identity:46/238 - (19%)
Similarity:75/238 - (31%) Gaps:65/238 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VFDRRKLRRCTI-SDSNSCASS------------------SSSSTSSRQSSED-----HLGLQGH 95
            |...|..|.|:: |.|.:|:.:                  .|......:..||     .:...|.
  Fly   327 VMTSRVPRACSMRSRSRACSEAWDRYDMDEEEEDEEDEEIESGGEELEEGEEDAMYARRMNFTGD 391

  Fly    96 SSVHHH-------------HGEQGEILNSTSLLEDEH--------------------ICPECGKK 127
            ..|:|.             :|:.|.:  .|.:..|:.                    ..|:||  
  Fly   392 WIVNHSRSNSNSAGNLSLLYGDYGMV--ETHMTTDKEYDLYLLDLLKTQVRLKSFTCFTPDCG-- 452

  Fly   128 YSTSSNLARHRQTHRSIMDKKARHCPYCEKVYVSMPAYSMHVRTHNQGCE-CQFCGKRFSRPWLL 191
            |.|.:.:|..:..:.........:|..|..|:.|......|:...|:|.. |..|.:.|.....|
  Fly   453 YQTDTLVALMKHDYMEHWKMSWFYCHKCGDVFTSKVFLDYHMHLQNRGLYICHKCREEFELQHQL 517

  Fly   192 QGHIRTHTGEKPFKCGVCEKAFADKSNLRAHIQT--HS-NTKP 231
            ..|.:.|.....:.|..|...|..::.|.||.:.  || |.:|
  Fly   518 DRHFQLHRKGINYHCNFCRLEFLSEAKLLAHCKKLGHSPNDEP 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KahNP_612040.1 zf-C2H2 119..141 CDD:278523 6/41 (15%)
C2H2 Zn finger 121..141 CDD:275368 6/19 (32%)
zf-C2H2 176..198 CDD:278523 5/22 (23%)
C2H2 Zn finger 178..198 CDD:275368 5/19 (26%)
zf-H2C2_2 191..214 CDD:290200 5/22 (23%)
zf-C2H2 204..226 CDD:278523 6/23 (26%)
C2H2 Zn finger 206..226 CDD:275368 6/21 (29%)
zf-H2C2_2 218..242 CDD:290200 7/17 (41%)
C2H2 Zn finger 234..250 CDD:275368
CG11906NP_611402.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457113
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.