Sequence 1: | NP_612040.1 | Gene: | Kah / 38072 | FlyBaseID: | FBgn0035144 | Length: | 442 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_611402.2 | Gene: | CG11906 / 37209 | FlyBaseID: | FBgn0034425 | Length: | 634 | Species: | Drosophila melanogaster |
Alignment Length: | 238 | Identity: | 46/238 - (19%) |
---|---|---|---|
Similarity: | 75/238 - (31%) | Gaps: | 65/238 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 55 VFDRRKLRRCTI-SDSNSCASS------------------SSSSTSSRQSSED-----HLGLQGH 95
Fly 96 SSVHHH-------------HGEQGEILNSTSLLEDEH--------------------ICPECGKK 127
Fly 128 YSTSSNLARHRQTHRSIMDKKARHCPYCEKVYVSMPAYSMHVRTHNQGCE-CQFCGKRFSRPWLL 191
Fly 192 QGHIRTHTGEKPFKCGVCEKAFADKSNLRAHIQT--HS-NTKP 231 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Kah | NP_612040.1 | zf-C2H2 | 119..141 | CDD:278523 | 6/41 (15%) |
C2H2 Zn finger | 121..141 | CDD:275368 | 6/19 (32%) | ||
zf-C2H2 | 176..198 | CDD:278523 | 5/22 (23%) | ||
C2H2 Zn finger | 178..198 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 191..214 | CDD:290200 | 5/22 (23%) | ||
zf-C2H2 | 204..226 | CDD:278523 | 6/23 (26%) | ||
C2H2 Zn finger | 206..226 | CDD:275368 | 6/21 (29%) | ||
zf-H2C2_2 | 218..242 | CDD:290200 | 7/17 (41%) | ||
C2H2 Zn finger | 234..250 | CDD:275368 | |||
CG11906 | NP_611402.2 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45457113 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24388 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |