DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kah and rgr

DIOPT Version :9

Sequence 1:NP_612040.1 Gene:Kah / 38072 FlyBaseID:FBgn0035144 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001163089.2 Gene:rgr / 35843 FlyBaseID:FBgn0267792 Length:889 Species:Drosophila melanogaster


Alignment Length:163 Identity:50/163 - (30%)
Similarity:66/163 - (40%) Gaps:27/163 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 VHH--HHGEQGEILNSTSLLEDEHICPECGKKYSTSSNLARHRQTHRSIMDKKARHCPY----CE 156
            ||.  |.|.|            ..||..|||.:....||..|.:.||       |..||    |:
  Fly   706 VHRSAHDGTQ------------PFICTLCGKGFQMPCNLTVHIRRHR-------RDFPYSCEQCD 751

  Fly   157 KVYVSMPAYSMHVRTH--NQGCECQFCGKRFSRPWLLQGHIRTHTGEKPFKCGVCEKAFADKSNL 219
            |.:.:....::|:|||  .:...|..|||.|........|.|.|..:..|.|.:|.|.|.:|:..
  Fly   752 KRFATSTEVAIHLRTHTGERPYICDLCGKSFKTWSFFDIHRRRHLNQSTFHCPICAKGFYEKNRF 816

  Fly   220 RAHIQTHSNTKPHTCARCGKAFALKSYLYKHEE 252
            ..|:.:|...:.|.|..|||.|.....|.||.|
  Fly   817 TDHMNSHWAIRKHLCTVCGKTFTTYGNLKKHTE 849

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KahNP_612040.1 zf-C2H2 119..141 CDD:278523 8/21 (38%)
C2H2 Zn finger 121..141 CDD:275368 7/19 (37%)
zf-C2H2 176..198 CDD:278523 7/21 (33%)
C2H2 Zn finger 178..198 CDD:275368 7/19 (37%)
zf-H2C2_2 191..214 CDD:290200 7/22 (32%)
zf-C2H2 204..226 CDD:278523 7/21 (33%)
C2H2 Zn finger 206..226 CDD:275368 6/19 (32%)
zf-H2C2_2 218..242 CDD:290200 7/23 (30%)
C2H2 Zn finger 234..250 CDD:275368 6/15 (40%)
rgrNP_001163089.2 MADF_DNA_bdg 335..420 CDD:287510
MADF_DNA_bdg 465..551 CDD:287510
MADF_DNA_bdg 595..682 CDD:287510
C2H2 Zn finger 691..711 CDD:275368 2/4 (50%)
C2H2 Zn finger 719..739 CDD:275368 7/19 (37%)
zf-H2C2_2 731..756 CDD:290200 10/31 (32%)
COG5048 742..>824 CDD:227381 23/81 (28%)
C2H2 Zn finger 747..767 CDD:275368 4/19 (21%)
zf-H2C2_2 763..784 CDD:290200 9/20 (45%)
C2H2 Zn finger 775..795 CDD:275368 7/19 (37%)
C2H2 Zn finger 803..818 CDD:275368 5/14 (36%)
C2H2 Zn finger 831..851 CDD:275368 9/19 (47%)
C2H2 Zn finger 859..877 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457118
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.