DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kah and prg

DIOPT Version :9

Sequence 1:NP_612040.1 Gene:Kah / 38072 FlyBaseID:FBgn0035144 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001260253.1 Gene:prg / 34177 FlyBaseID:FBgn0285971 Length:558 Species:Drosophila melanogaster


Alignment Length:507 Identity:115/507 - (22%)
Similarity:174/507 - (34%) Gaps:148/507 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IPEELYNLTQLAEVTLSVGPLVTDEVKPLPLYASSDD------DSNYYSHKVFDRRKLRRCTISD 68
            :|||              |.::. ||.|..|..||::      |..|.::...|..:.......|
  Fly   117 VPEE--------------GCIIV-EVDPENLAESSEEEFALGSDGEYENYDDDDEEEEEDYDEED 166

  Fly    69 SNSCASSSSSSTSSRQSSED---HLGLQGHSSVHHHHGEQGEILNSTSLLEDE----HICPECGK 126
            .           ...|:.||   .||:.....     ..|..:.|:.:..|..    .:|..|..
  Fly   167 E-----------EDGQNGEDVDMPLGMDAAQM-----AAQQSVANNANTTEARPKRAFLCQYCDL 215

  Fly   127 KYSTSSNLARHR-QTHRSIMDKKARH-CPYCEKVYVSMPAYSMHVRT-H--NQGCECQFCGKRFS 186
            .::..:....|. ..|    |..|.: |.:|....|:.||...|::| |  ::...|..|.|.|.
  Fly   216 GFTLPAECQEHELAAH----DPNAPYCCNFCNIKLVTRPALISHIKTLHDPDRPYVCAHCRKGFV 276

  Fly   187 RPWLLQGHIRTHTGEKPFKCGVCEKAFADKSNLRAHIQTHSNTKPHTCARCGKAFALKSYLYKHE 251
            |...|:.|...|||.:||.|.||.|:|:..:||..|::.||..||..|.:|.::|.....:.:|.
  Fly   277 RRSDLKKHTIVHTGVRPFTCNVCSKSFSRNTNLTKHMRIHSGVKPFVCQQCPRSFQTAVEMMRHT 341

  Fly   252 ES-------SCMKNRGGVPGSGA---------------------ASGNRPPSSPKRQQAEVTSGT 288
            .|       .|    |..|.|.:                     ..|..||.....||       
  Fly   342 RSHGEVKAFQC----GRCPYSFSRRDKLIAHQQVHTRRDMEQQQQMGLIPPMEGDLQQ------- 395

  Fly   289 ISALAPGSPAAAVCAASDSAKSTLANKLLQKEKD--RRQA---------AMAFQGF--------- 333
             .||.....|||....|......:.::..|:|:|  |.||         ....|||         
  Fly   396 -QALQAKQKAAAQTKNSRYYHCDVCDRTFQRERDLQRHQALHMDSLFACKTCNQGFNRREQLQRH 459

  Fly   334 ---PAGPEVT------AYSHATSAQEEYEKFKRINVIQPKVMPHRVPSLYQD--LLPNRHVPLAL 387
               ..||..|      ::.|    |.|.|...:::.:|     |::....|:  :||.:....| 
  Fly   460 ELEAHGPSFTCGICCISFLH----QIELENHLKVHQLQ-----HKMAQRAQEAAILPLKMAEKA- 514

  Fly   388 PLAMPYHFQGQATSTGQSDPTSVQEQPVDFS------PKNNFTHSAKTSPFE 433
            |:||        |:....||..|:....:.|      |..|....::|.|.|
  Fly   515 PVAM--------TAPLVQDPQLVRPSAAELSFYSNMIPTMNLGFYSETRPEE 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KahNP_612040.1 zf-C2H2 119..141 CDD:278523 3/22 (14%)
C2H2 Zn finger 121..141 CDD:275368 3/20 (15%)
zf-C2H2 176..198 CDD:278523 7/21 (33%)
C2H2 Zn finger 178..198 CDD:275368 7/19 (37%)
zf-H2C2_2 191..214 CDD:290200 11/22 (50%)
zf-C2H2 204..226 CDD:278523 9/21 (43%)
C2H2 Zn finger 206..226 CDD:275368 8/19 (42%)
zf-H2C2_2 218..242 CDD:290200 9/23 (39%)
C2H2 Zn finger 234..250 CDD:275368 3/15 (20%)
prgNP_001260253.1 zf-AD 16..94 CDD:285071
COG5048 <212..340 CDD:227381 40/131 (31%)
C2H2 Zn finger 239..260 CDD:275368 7/20 (35%)
C2H2 Zn finger 268..288 CDD:275368 7/19 (37%)
zf-H2C2_2 280..305 CDD:290200 12/24 (50%)
zf-C2H2 294..316 CDD:278523 9/21 (43%)
C2H2 Zn finger 296..316 CDD:275368 8/19 (42%)
zf-H2C2_2 308..331 CDD:290200 9/22 (41%)
C2H2 Zn finger 324..344 CDD:275368 4/19 (21%)
C2H2 Zn finger 352..372 CDD:275368 4/23 (17%)
C2H2 Zn finger 416..436 CDD:275368 6/19 (32%)
C2H2 Zn finger 443..464 CDD:275368 3/20 (15%)
C2H2 Zn finger 470..490 CDD:275368 4/23 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.