DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kah and SNAI3

DIOPT Version :9

Sequence 1:NP_612040.1 Gene:Kah / 38072 FlyBaseID:FBgn0035144 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_840101.1 Gene:SNAI3 / 333929 HGNCID:18411 Length:292 Species:Homo sapiens


Alignment Length:164 Identity:81/164 - (49%)
Similarity:98/164 - (59%) Gaps:19/164 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 STSLLEDEHICPE-------------------CGKKYSTSSNLARHRQTHRSIMDKKARHCPYCE 156
            |.:|..|.|..||                   |.|.|.|.:.||||||.|..:...:...|.||:
Human   125 SPTLGPDRHGAPEKLLGAERMPRAPGGFECFHCHKPYHTLAGLARHRQLHCHLQVGRVFTCKYCD 189

  Fly   157 KVYVSMPAYSMHVRTHNQGCECQFCGKRFSRPWLLQGHIRTHTGEKPFKCGVCEKAFADKSNLRA 221
            |.|.|:.|..||:|||...|.|:.|||.||||||||||:||||||||:.|..|.:||||:|||||
Human   190 KEYTSLGALKMHIRTHTLPCTCKICGKAFSRPWLLQGHVRTHTGEKPYACSHCSRAFADRSNLRA 254

  Fly   222 HIQTHSNTKPHTCARCGKAFALKSYLYKHEESSC 255
            |:||||:.|.:.|.||.|.|:..|.|.:||||.|
Human   255 HLQTHSDAKKYRCRRCTKTFSRMSLLARHEESGC 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KahNP_612040.1 zf-C2H2 119..141 CDD:278523 13/40 (33%)
C2H2 Zn finger 121..141 CDD:275368 12/38 (32%)
zf-C2H2 176..198 CDD:278523 16/21 (76%)
C2H2 Zn finger 178..198 CDD:275368 15/19 (79%)
zf-H2C2_2 191..214 CDD:290200 15/22 (68%)
zf-C2H2 204..226 CDD:278523 13/21 (62%)
C2H2 Zn finger 206..226 CDD:275368 13/19 (68%)
zf-H2C2_2 218..242 CDD:290200 14/23 (61%)
C2H2 Zn finger 234..250 CDD:275368 7/15 (47%)
SNAI3NP_840101.1 SNAG domain. /evidence=ECO:0000250 1..20
C2H2 Zn finger 154..174 CDD:275370 10/19 (53%)
C2H2 Zn finger 185..205 CDD:275368 10/19 (53%)
COG5048 <206..>278 CDD:227381 45/71 (63%)
C2H2 Zn finger 211..231 CDD:275368 15/19 (79%)
C2H2 Zn finger 239..259 CDD:275368 13/19 (68%)
C2H2 Zn finger 267..283 CDD:275368 7/15 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.