DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kah and CG15446

DIOPT Version :9

Sequence 1:NP_612040.1 Gene:Kah / 38072 FlyBaseID:FBgn0035144 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_608430.2 Gene:CG15446 / 33088 FlyBaseID:FBgn0031155 Length:373 Species:Drosophila melanogaster


Alignment Length:66 Identity:17/66 - (25%)
Similarity:32/66 - (48%) Gaps:7/66 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 GEKP----FKCGV--CEKAFADKSNLRAH-IQTHSNTKPHTCARCGKAFALKSYLYKHEESSCMK 257
            |..|    |.|.:  |::.|..:..:..| .:|..:..||.|::||:.|....::..|..::|.:
  Fly   286 GRHPPFSVFSCPLDYCKENFDSRRAMYKHQRETGHHNWPHNCSKCGQVFRTSGFMRMHSVNACAR 350

  Fly   258 N 258
            |
  Fly   351 N 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KahNP_612040.1 zf-C2H2 119..141 CDD:278523
C2H2 Zn finger 121..141 CDD:275368
zf-C2H2 176..198 CDD:278523
C2H2 Zn finger 178..198 CDD:275368
zf-H2C2_2 191..214 CDD:290200 5/19 (26%)
zf-C2H2 204..226 CDD:278523 5/24 (21%)
C2H2 Zn finger 206..226 CDD:275368 4/22 (18%)
zf-H2C2_2 218..242 CDD:290200 7/24 (29%)
C2H2 Zn finger 234..250 CDD:275368 4/15 (27%)
CG15446NP_608430.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.