DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kah and CG10959

DIOPT Version :9

Sequence 1:NP_612040.1 Gene:Kah / 38072 FlyBaseID:FBgn0035144 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster


Alignment Length:327 Identity:80/327 - (24%)
Similarity:123/327 - (37%) Gaps:79/327 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DQQATPIPEELYNLTQLAEVT-----LSVGPLVTDEVKP--LP---LYASSDDDSNYYSHKVFDR 58
            |:|..|:.:.:..|.:||...     :|..||..|..|.  ||   :.:..:|.......:..:.
  Fly    63 DKQGRPLTKTVTGLGRLAREEQEFQGVSAEPLAVDSFKKEYLPNEDVLSEEEDAEQELGLEQDEG 127

  Fly    59 RKLRRCTISDSNSC------------ASSSSSSTSSRQSSEDHLGLQGHSSVH-HHHGEQGEILN 110
            ..||...:....|.            ..|||:|.:...:.|..||::...... ...||:.:.:.
  Fly   128 NPLRIMVLGGKQSVDEETIDTMWQPDHDSSSASVNEGCALEALLGVENPQDYQPDEDGEEHQSVF 192

  Fly   111 STSLLEDEHICPECGKKYSTSSNLARH-RQTH-----------RSIMD--------KKARH---- 151
            .......::.||.|.::|:|...|..| :.:|           ::..|        ::..|    
  Fly   193 KKQRQPKDYNCPHCDRRYTTQKYLNTHLKMSHPFPQAFKCVDCKATFDVDRALAQHRRKEHTEFA 257

  Fly   152 CPYCEKVYVSMPAYSMHVRTHNQG----CE----------------------------CQFCGKR 184
            |..|:||:.|..:...||:.|:..    ||                            |:.||.|
  Fly   258 CQLCDKVFKSSRSLLRHVQGHSGARTFKCEHENCGKSFVNQHNLTSHRRVHSEERNYVCELCGYR 322

  Fly   185 FSRPWLLQGHIRTHTGEKPFKCGVCEKAFADKSNLRAHIQTHSNTKPHTCARCGKAFALKSYLYK 249
            ......|..|.|||||||||:|..|.:.||.||.|..|...||..||:.|.:|..||:....||.
  Fly   323 SRYREALIVHRRTHTGEKPFQCQTCARRFASKSLLNEHQAMHSTEKPYKCDKCDSAFSRPKALYH 387

  Fly   250 HE 251
            |:
  Fly   388 HK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KahNP_612040.1 zf-C2H2 119..141 CDD:278523 7/22 (32%)
C2H2 Zn finger 121..141 CDD:275368 7/20 (35%)
zf-C2H2 176..198 CDD:278523 9/49 (18%)
C2H2 Zn finger 178..198 CDD:275368 7/19 (37%)
zf-H2C2_2 191..214 CDD:290200 13/22 (59%)
zf-C2H2 204..226 CDD:278523 9/21 (43%)
C2H2 Zn finger 206..226 CDD:275368 8/19 (42%)
zf-H2C2_2 218..242 CDD:290200 9/23 (39%)
C2H2 Zn finger 234..250 CDD:275368 6/15 (40%)
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 1/20 (5%)
COG5048 <258..416 CDD:227381 44/132 (33%)
C2H2 Zn finger 258..278 CDD:275368 7/19 (37%)
C2H2 Zn finger 289..308 CDD:275368 0/18 (0%)
C2H2 Zn finger 316..336 CDD:275368 7/19 (37%)
zf-H2C2_2 328..353 CDD:290200 14/24 (58%)
C2H2 Zn finger 344..364 CDD:275368 8/19 (42%)
zf-H2C2_2 357..381 CDD:290200 10/23 (43%)
C2H2 Zn finger 372..392 CDD:275368 7/18 (39%)
C2H2 Zn finger 400..420 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.