Sequence 1: | NP_612040.1 | Gene: | Kah / 38072 | FlyBaseID: | FBgn0035144 | Length: | 442 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_572451.1 | Gene: | CG10959 / 31743 | FlyBaseID: | FBgn0030010 | Length: | 443 | Species: | Drosophila melanogaster |
Alignment Length: | 327 | Identity: | 80/327 - (24%) |
---|---|---|---|
Similarity: | 123/327 - (37%) | Gaps: | 79/327 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 DQQATPIPEELYNLTQLAEVT-----LSVGPLVTDEVKP--LP---LYASSDDDSNYYSHKVFDR 58
Fly 59 RKLRRCTISDSNSC------------ASSSSSSTSSRQSSEDHLGLQGHSSVH-HHHGEQGEILN 110
Fly 111 STSLLEDEHICPECGKKYSTSSNLARH-RQTH-----------RSIMD--------KKARH---- 151
Fly 152 CPYCEKVYVSMPAYSMHVRTHNQG----CE----------------------------CQFCGKR 184
Fly 185 FSRPWLLQGHIRTHTGEKPFKCGVCEKAFADKSNLRAHIQTHSNTKPHTCARCGKAFALKSYLYK 249
Fly 250 HE 251 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Kah | NP_612040.1 | zf-C2H2 | 119..141 | CDD:278523 | 7/22 (32%) |
C2H2 Zn finger | 121..141 | CDD:275368 | 7/20 (35%) | ||
zf-C2H2 | 176..198 | CDD:278523 | 9/49 (18%) | ||
C2H2 Zn finger | 178..198 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 191..214 | CDD:290200 | 13/22 (59%) | ||
zf-C2H2 | 204..226 | CDD:278523 | 9/21 (43%) | ||
C2H2 Zn finger | 206..226 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 218..242 | CDD:290200 | 9/23 (39%) | ||
C2H2 Zn finger | 234..250 | CDD:275368 | 6/15 (40%) | ||
CG10959 | NP_572451.1 | C2H2 Zn finger | 232..253 | CDD:275368 | 1/20 (5%) |
COG5048 | <258..416 | CDD:227381 | 44/132 (33%) | ||
C2H2 Zn finger | 258..278 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 289..308 | CDD:275368 | 0/18 (0%) | ||
C2H2 Zn finger | 316..336 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 328..353 | CDD:290200 | 14/24 (58%) | ||
C2H2 Zn finger | 344..364 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 357..381 | CDD:290200 | 10/23 (43%) | ||
C2H2 Zn finger | 372..392 | CDD:275368 | 7/18 (39%) | ||
C2H2 Zn finger | 400..420 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24388 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |