DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kah and rsv1

DIOPT Version :9

Sequence 1:NP_612040.1 Gene:Kah / 38072 FlyBaseID:FBgn0035144 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_596183.1 Gene:rsv1 / 2541322 PomBaseID:SPBP4H10.09 Length:428 Species:Schizosaccharomyces pombe


Alignment Length:316 Identity:70/316 - (22%)
Similarity:112/316 - (35%) Gaps:78/316 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 ECQFCGKRFSRPWLLQGHIRTHTGEKPFKCGV--CEKAFADKSNLRAHIQTHSNTKPHTCARCGK 239
            ||.||.:.|.|......|||:|||||||:|..  |:|.|..:..|..|::||             
pombe     5 ECPFCKRVFHRQEHQVRHIRSHTGEKPFECSYPSCKKRFTRRDELIRHVRTH------------- 56

  Fly   240 AFALKSYLYKHEESSCMKNRGGVPGSGAASGNRPPSSPKRQQAEVTSGTIS----------ALAP 294
               |:..|...|::..: |....|.|.............:.|.:...|:|:          ::|.
pombe    57 ---LRKALVTPEQTLDV-NLHKAPDSKPEGDKSTGQEADKSQNQSKDGSITDPVQAAVLALSVAY 117

  Fly   295 GSPAAAVCAASD-SAKSTLANK------------LLQKEKDRRQAAMAFQGFPAGPEVTAYSHAT 346
            ..|.:...:.:| .|:|.|..|            |.:|.:|..:.....:...|.....:.|::.
pombe   118 AKPTSVSLSPTDLQAQSKLIEKPRRRSASNATGSLNKKNQDPLRRFSISESAGAAAPTPSPSNSK 182

  Fly   347 SAQEEYEKFKRINVIQPKVMPHRVPSLYQDLLPNRHVPLALPLAMPYHFQGQATST-------GQ 404
            |...|..|.:..||:.| :..:.||...|: .|....|:.|......:..||.|.|       .:
pombe   183 SPPSENRKNRLQNVLSP-IASNNVPDFNQN-YPTESNPMFLSTPRFQNTNGQRTLTVPVSVWDAR 245

  Fly   405 SDPTS-----------------------VQEQPVDFSPKNNFTHSAKTS----PFE 433
            ..|||                       |.:..:::...|.:.|....|    ||:
pombe   246 QPPTSSRSGLPLSVMYNHFPSVPIPPATVNDTSMEYYLPNAYPHPTGISLPFYPFD 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KahNP_612040.1 zf-C2H2 119..141 CDD:278523
C2H2 Zn finger 121..141 CDD:275368
zf-C2H2 176..198 CDD:278523 9/20 (45%)
C2H2 Zn finger 178..198 CDD:275368 8/19 (42%)
zf-H2C2_2 191..214 CDD:290200 13/24 (54%)
zf-C2H2 204..226 CDD:278523 7/23 (30%)
C2H2 Zn finger 206..226 CDD:275368 6/21 (29%)
zf-H2C2_2 218..242 CDD:290200 4/23 (17%)
C2H2 Zn finger 234..250 CDD:275368 2/15 (13%)
rsv1NP_596183.1 COG5048 1..427 CDD:227381 70/316 (22%)
zf-C2H2 4..26 CDD:278523 9/20 (45%)
C2H2 Zn finger 6..26 CDD:275368 8/19 (42%)
zf-H2C2_2 21..45 CDD:290200 14/23 (61%)
C2H2 Zn finger 34..56 CDD:275368 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2026
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.