DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kah and snai-1

DIOPT Version :9

Sequence 1:NP_612040.1 Gene:Kah / 38072 FlyBaseID:FBgn0035144 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_499902.2 Gene:snai-1 / 186874 WormBaseID:WBGene00019299 Length:193 Species:Caenorhabditis elegans


Alignment Length:222 Identity:93/222 - (41%)
Similarity:119/222 - (53%) Gaps:46/222 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 TISD--SNSCASSSSSSTSSRQSSEDHLGLQGHSSVHHHHGEQGEILNSTSLLEDEHICPECGKK 127
            ||.|  |...|.|||||::|                            .:||...:.:|..|.|.
 Worm    13 TIEDLISPDPAPSSSSSSAS----------------------------CSSLDNQKLVCQFCKKT 49

  Fly   128 YSTSSNLARHRQTHRSIMDKKARHCPYCEKVYVSMPAYSMHVRTHNQGCECQFCGKRFSRPWLLQ 192
            |.|...|.||.|.|:.  .|..:.||:|:|||.|..|..||::||:..|.|..|||.|||||||:
 Worm    50 YLTYFGLRRHLQFHKE--GKLQQSCPHCKKVYRSPGALKMHLKTHSLPCVCNDCGKSFSRPWLLK 112

  Fly   193 GHIRTHTGEKPFKCGVCEKAFADKSNLRAHIQTHSNTKPHTCARCGKAFALKSYLYKHEESSCMK 257
            ||:|||||||||.|..|.:.|||:||||||:||||..|.|.|:|||::||......:||:  |. 
 Worm   113 GHLRTHTGEKPFGCEFCGRCFADRSNLRAHLQTHSGEKKHRCSRCGQSFARVQVRQRHEQ--CC- 174

  Fly   258 NRGGVPGSGAASGNRPPSSPKRQQAEV 284
             |||  |||..:        :::..||
 Worm   175 -RGG--GSGGEA--------EKEDVEV 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KahNP_612040.1 zf-C2H2 119..141 CDD:278523 9/21 (43%)
C2H2 Zn finger 121..141 CDD:275368 9/19 (47%)
zf-C2H2 176..198 CDD:278523 15/21 (71%)
C2H2 Zn finger 178..198 CDD:275368 14/19 (74%)
zf-H2C2_2 191..214 CDD:290200 14/22 (64%)
zf-C2H2 204..226 CDD:278523 13/21 (62%)
C2H2 Zn finger 206..226 CDD:275368 12/19 (63%)
zf-H2C2_2 218..242 CDD:290200 15/23 (65%)
C2H2 Zn finger 234..250 CDD:275368 6/15 (40%)
snai-1NP_499902.2 C2H2 Zn finger 72..92 CDD:275368 10/19 (53%)
COG5048 98..>155 CDD:227381 39/56 (70%)
C2H2 Zn finger 98..118 CDD:275368 14/19 (74%)
C2H2 Zn finger 126..146 CDD:275368 12/19 (63%)
zf-H2C2_2 138..163 CDD:290200 16/24 (67%)
C2H2 Zn finger 154..170 CDD:275368 6/15 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.