DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kah and scrt-1

DIOPT Version :9

Sequence 1:NP_612040.1 Gene:Kah / 38072 FlyBaseID:FBgn0035144 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_491001.2 Gene:scrt-1 / 183848 WormBaseID:WBGene00016948 Length:178 Species:Caenorhabditis elegans


Alignment Length:173 Identity:79/173 - (45%)
Similarity:94/173 - (54%) Gaps:50/173 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 SLLEDEHICPECGKKYSTSSNLARHRQTHRSIMDKKARHCPY--CEKVYVSMPAYSMH------- 168
            ||:|      |..|||::...|.               ..||  ......|:|::|:|       
 Worm    23 SLIE------EVQKKYNSQVRLI---------------PIPYLPASSSSPSLPSFSLHSDSPSLS 66

  Fly   169 --------------------VRTHNQGCECQFCGKRFSRPWLLQGHIRTHTGEKPFKCGVCEKAF 213
                                ..|.:..|:|:.|||||||.||||||:|||||||||:|.:|.|.|
 Worm    67 PSTTVTSYSTPSSPDGKQLKFATCSPVCQCKVCGKRFSRQWLLQGHLRTHTGEKPFQCEICSKRF 131

  Fly   214 ADKSNLRAHIQTHSNTKPHTCARCGKAFALKSYLYKHEESSCM 256
            ||||||||||||||.||||.|.||||:|||||||.|||||.|:
 Worm   132 ADKSNLRAHIQTHSGTKPHKCPRCGKSFALKSYLSKHEESKCL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KahNP_612040.1 zf-C2H2 119..141 CDD:278523 5/21 (24%)
C2H2 Zn finger 121..141 CDD:275368 5/19 (26%)
zf-C2H2 176..198 CDD:278523 16/21 (76%)
C2H2 Zn finger 178..198 CDD:275368 15/19 (79%)
zf-H2C2_2 191..214 CDD:290200 16/22 (73%)
zf-C2H2 204..226 CDD:278523 16/21 (76%)
C2H2 Zn finger 206..226 CDD:275368 15/19 (79%)
zf-H2C2_2 218..242 CDD:290200 19/23 (83%)
C2H2 Zn finger 234..250 CDD:275368 12/15 (80%)
scrt-1NP_491001.2 zf-C2H2 94..116 CDD:278523 16/21 (76%)
C2H2 Zn finger 96..116 CDD:275368 15/19 (79%)
zf-H2C2_2 109..132 CDD:290200 16/22 (73%)
C2H2 Zn finger 124..144 CDD:275368 15/19 (79%)
zf-H2C2_2 136..160 CDD:290200 19/23 (83%)
C2H2 Zn finger 152..168 CDD:275368 12/15 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159580
Domainoid 1 1.000 46 1.000 Domainoid score I8201
eggNOG 1 0.900 - - E1_KOG2462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000984
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3156
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.730

Return to query results.
Submit another query.