DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kah and Snai1

DIOPT Version :9

Sequence 1:NP_612040.1 Gene:Kah / 38072 FlyBaseID:FBgn0035144 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_446257.1 Gene:Snai1 / 116490 RGDID:620758 Length:264 Species:Rattus norvegicus


Alignment Length:263 Identity:97/263 - (36%)
Similarity:128/263 - (48%) Gaps:60/263 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ATPIPEELYNLTQLAEVTLSVGPLVTDEVKP-----LPLYAS---------SDDDSNYYSHKVFD 57
            |.|.||.|.....|.  ||....|:..:|:|     |||..|         ||:||...|...  
  Rat    43 AIPPPEVLNPAASLP--TLIWDSLLVPQVQPVAWATLPLRESPRAAELTSLSDEDSGKSSQPP-- 103

  Fly    58 RRKLRRCTISDSNSCASSSSSSTSSRQSSEDHLGLQGHSSVHHHHGEQGEILNSTSLLEDEHICP 122
                     |..:...||.||:::|...:|..:...|       .|:..:.|...|:.:|    |
  Rat   104 ---------SPPSPAPSSFSSTSASSLEAEAFIAFPG-------LGQLPKQLARLSVAKD----P 148

  Fly   123 ECGKKYSTSSNLARHRQTHRSIMDKKARHCPYCEKVYVSMPAYSMHVRTHNQGCECQFCGKRFSR 187
            :                      .:||.:|.||.|.|:|:.|..||:|:|...|.|..|||.|||
  Rat   149 Q----------------------SRKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCTTCGKAFSR 191

  Fly   188 PWLLQGHIRTHTGEKPFKCGVCEKAFADKSNLRAHIQTHSNTKPHTCARCGKAFALKSYLYKHEE 252
            |||||||:|||||||||.|..|.:||||:||||||:||||:.|.:.|..|.:.|:..|.|:||:|
  Rat   192 PWLLQGHVRTHTGEKPFSCSHCNRAFADRSNLRAHLQTHSDVKRYQCQACARTFSRMSLLHKHQE 256

  Fly   253 SSC 255
            |.|
  Rat   257 SGC 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KahNP_612040.1 zf-C2H2 119..141 CDD:278523 1/21 (5%)
C2H2 Zn finger 121..141 CDD:275368 1/19 (5%)
zf-C2H2 176..198 CDD:278523 16/21 (76%)
C2H2 Zn finger 178..198 CDD:275368 15/19 (79%)
zf-H2C2_2 191..214 CDD:290200 16/22 (73%)
zf-C2H2 204..226 CDD:278523 14/21 (67%)
C2H2 Zn finger 206..226 CDD:275368 13/19 (68%)
zf-H2C2_2 218..242 CDD:290200 12/23 (52%)
C2H2 Zn finger 234..250 CDD:275368 5/15 (33%)
Snai1NP_446257.1 C2H2 Zn finger 156..176 CDD:275368 10/19 (53%)
COG5048 <177..>253 CDD:227381 46/75 (61%)
zf-C2H2 180..202 CDD:278523 16/21 (76%)
C2H2 Zn finger 182..202 CDD:275368 15/19 (79%)
zf-H2C2_2 195..218 CDD:290200 16/22 (73%)
zf-C2H2 208..230 CDD:278523 14/21 (67%)
C2H2 Zn finger 210..230 CDD:275368 13/19 (68%)
C2H2 Zn finger 238..255 CDD:275368 6/16 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.