DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and PPM1F

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_055449.1 Gene:PPM1F / 9647 HGNCID:19388 Length:454 Species:Homo sapiens


Alignment Length:291 Identity:95/291 - (32%)
Similarity:134/291 - (46%) Gaps:35/291 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KDTACCANASYR---VGSSCMQGWRVDMEDAH------THILSLPDDPQAAFFAVYDGHGGASVA 67
            |.....|.||.|   |....::..|..|||.|      ..:..|.|....|:|||:|||||...|
Human   142 KQVPLAARASQRQWLVSIHAIRNTRRKMEDRHVSLPSFNQLFGLSDPVNRAYFAVFDGHGGVDAA 206

  Fly    68 KYAGKHLHKFITKRPEYRDNSIEVALKKAFLDFDREMLQNGSLDEQTAGCTAIVVLIRERRLYCA 132
            :||..|:|....::||...:. |.||::||...|:..|:....:...:|.|.:..||....|:.|
Human   207 RYAAVHVHTNAARQPELPTDP-EGALREAFRRTDQMFLRKAKRERLQSGTTGVCALIAGATLHVA 270

  Fly   133 NAGDSRAIACISGMVHALSVDHKPNDAKESKRIMASGGWVEFN---RVNGNLALSRALGDFIYKK 194
            ..|||:.|....|.|..|...|:|....|..||.|.||:|...   ||||.||:|||:||...| 
Human   271 WLGDSQVILVQQGQVVKLMEPHRPERQDEKARIEALGGFVSHMDCWRVNGTLAVSRAIGDVFQK- 334

  Fly   195 NLLKTPEEQIVTAYPDVEVLDITEDLEFVLLACDGIWDVMSNFEVCQFVHKRIR----DGMEPEL 255
                    ..|:...|.....:|...:::||||||.:||:.:.||...|...:.    .|:.   
Human   335 --------PYVSGEADAASRALTGSEDYLLLACDGFFDVVPHQEVVGLVQSHLTRQQGSGLR--- 388

  Fly   256 ICEELMNSCLSPDGHTGNVGGDNMTVILVCL 286
            :.|||:.:......|      ||:||::|.|
Human   389 VAEELVAAARERGSH------DNITVMVVFL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 90/279 (32%)
PPM1FNP_055449.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
PP2C 155..406 CDD:278884 85/269 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..454
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144748
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R955
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.