DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and PTC7

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_011943.2 Gene:PTC7 / 856475 SGDID:S000001118 Length:343 Species:Saccharomyces cerevisiae


Alignment Length:280 Identity:60/280 - (21%)
Similarity:109/280 - (38%) Gaps:92/280 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 FFAVYDGHGGASVAKYAGKHLHKFITKRPE-----YRDNSIEVAL---KK----AFLDF-DREML 105
            |..|.||.||.:...|....:.:.:.|:.:     ..:||.:..|   ||    |:... |.:::
Yeast   104 FAGVADGVGGWAEHGYDSSAISRELCKKMDEISTALAENSSKETLLTPKKIIGAAYAKIRDEKVV 168

  Fly   106 QNGSLDEQTAGCTAIVVLIRER-RLYCANAGDSRAIACISGMVHALSVDHKPNDAKESKRIMASG 169
            :.|       |.||||...... :|..||.|||..     |:.            ::||.:..: 
Yeast   169 KVG-------GTTAIVAHFPSNGKLEVANLGDSWC-----GVF------------RDSKLVFQT- 208

  Fly   170 GWVEFNRVNGNLALSRALGDFIYKKNLLKTPEEQIVTA------YPDVEVLDITEDL-------- 220
               :|..|..|..         |:.:::  |||.:..|      |    :|:...|.        
Yeast   209 ---KFQTVGFNAP---------YQLSII--PEEMLKEAERRGSKY----ILNTPRDADEYSFQLK 255

  Fly   221 --EFVLLACDGIWDVMSNFEVCQFV-HKRIRDGMEPELICEELMNS--CLSPDGHTGNV------ 274
              :.::||.||:.|.::..::..|: ....|...|.:|:.::.:::  .||.|.:..:|      
Yeast   256 KKDIIILATDGVTDNIATDDIELFLKDNAARTNDELQLLSQKFVDNVVSLSKDPNYPSVFAQEIS 320

  Fly   275 --------GG--DNMTVILV 284
                    ||  |::||::|
Yeast   321 KLTGKNYSGGKEDDITVVVV 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 60/280 (21%)
PTC7NP_011943.2 PTC1 50..343 CDD:223704 60/280 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.