DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and PTC5

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_014733.1 Gene:PTC5 / 854257 SGDID:S000005616 Length:572 Species:Saccharomyces cerevisiae


Alignment Length:401 Identity:92/401 - (22%)
Similarity:155/401 - (38%) Gaps:104/401 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 MEDAHT-HILSLPDDPQAA--------FFAVYDGHGGASVAKYAGKHLHKFITKR--PEYRDNS- 88
            :||.|. .|:::|.:.:..        ||.::|||||...::...|.|.:::..:  ..|..|. 
Yeast   165 IEDDHVEQIITIPIESEDGKSIEKDLYFFGIFDGHGGPFTSEKLSKDLVRYVAYQLGQVYDQNKT 229

  Fly    89 ---------IEVALKKAFLDFDREML----------QNGSLDEQT----AGCTAIVVLIRERR-- 128
                     |:.|:.|.||..|.:::          .|.:....|    :|..|::.|.....  
Yeast   230 VFHSDPNQLIDSAISKGFLKLDNDLVIESFRKLFQDPNNTNIANTLPAISGSCALLSLYNSTNSI 294

  Fly   129 LYCANAGDSRAIACISGM-------VHALSVDHKPNDAKESKRIM----ASGGWVEFNRVNGNLA 182
            |..|..|||||:.|  |:       |.:||.|...::..|.:||.    .....:...|:.|:|.
Yeast   295 LKVAVTGDSRALIC--GLDNEGNWTVKSLSTDQTGDNLDEVRRIRKEHPGEPNVIRNGRILGSLQ 357

  Fly   183 LSRALGDFIYK------KNLLKTPE---------------EQIVTAYPDVEVLDITEDLEFVLLA 226
            .|||.||:.||      |.|...||               ...|||.|.:....|.|:.:|:::.
Yeast   358 PSRAFGDYRYKIKEVDGKPLSDLPEVAKLYFRREPRDFKTPPYVTAEPVITSAKIGENTKFMVMG 422

  Fly   227 CDGIWDVMSNFEVCQFVHK-----------RIRDGMEPELICEELMNSCLSP-----DGHTGNVG 275
            .||::::::|.|:...|.:           :...|..|::|..........|     |.::.:..
Yeast   423 SDGLFELLTNEEIASLVIRWMDKNMNLAPVKAEPGKLPKVIDVSEDKEAQRPAFRYKDNNSSSPS 487

  Fly   276 GDNMTVILVCLLHNKSYEDLAVR---CGGKRKTPVETVGDIQDQSVKVVTPCSQGSSGSSTSRLG 337
            |.|...    |:.:|:.....:|   ..|.||..|..:       |.:.:|.|:......|..:.
Yeast   488 GSNPEY----LIEDKNVATHLIRNALSAGGRKEYVSAL-------VSIPSPMSRRYRDDLTVTVA 541

  Fly   338 LGFGLRESETP 348
            . ||  :|.||
Yeast   542 F-FG--DSGTP 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 76/334 (23%)
PTC5NP_014733.1 PP2C 182..464 CDD:395385 66/283 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.