DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and AT4G31860

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_194914.1 Gene:AT4G31860 / 829315 AraportID:AT4G31860 Length:357 Species:Arabidopsis thaliana


Alignment Length:356 Identity:127/356 - (35%)
Similarity:189/356 - (53%) Gaps:66/356 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGQTLSEPVTTKDTACCANASYRVGSSCMQGWRVDMEDAHTHILSLPDDPQAAFFAVYDGHGGAS 65
            ||..||.|.|.|.:....|...|.|.|.|||||..|||||..||.|.|:  .:|..|||||||..
plant     1 MGIYLSTPKTDKFSEDGENHKLRYGLSSMQGWRASMEDAHAAILDLDDN--TSFLGVYDGHGGKV 63

  Fly    66 VAKYAGKHLHKFITKRPEYRDNSIEVALKKAFLDFDREMLQ------------------NGSLD- 111
            |:|:..|:||:.:.....|....:..:|:|||...| ||:|                  :|.:: 
plant    64 VSKFCAKYLHQQVLSDEAYAAGDVGTSLQKAFFRMD-EMMQGQRGWRELAVLGDKINKFSGMIEG 127

  Fly   112 -------------------EQ---------TAGCTAIVVLIRERRLYCANAGDSRAIACISGMVH 148
                               |:         .:|.||.|.::|:::|:.|||||||.:.......:
plant   128 LIWSPRSGDSANKPDAWAFEEGPHSDFAGPNSGSTACVAVVRDKQLFVANAGDSRCVISRKNQAY 192

  Fly   149 ALSVDHKPNDAKESKRIMASGGWVEFNRVNGNLALSRALGDFIYKKNLLKTPEEQIVTAYPDVEV 213
            .||.||||:...|.:||:.:||::...||||:|.||||:||..:|:|.....|:|||||.|||..
plant   193 NLSRDHKPDLEAEKERILKAGGFIHAGRVNGSLNLSRAIGDMEFKQNKFLPSEKQIVTASPDVNT 257

  Fly   214 LDITEDLEFVLLACDGIWDVMSNFEVCQFVHKRIRDGMEPELICEELMNSCLSPDGHTGNVGGDN 278
            :::.:|.:|::||||||||.|::.::..|:|:::....:..::||::::.||:|: .:|..|.||
plant   258 VELCDDDDFLVLACDGIWDCMTSQQLVDFIHEQLNSETKLSVVCEKVLDRCLAPN-TSGGEGCDN 321

  Fly   279 MTVILVCLLHNKSYEDLAVRCGGKRKTPVET 309
            ||:|||..               |..||.||
plant   322 MTMILVRF---------------KNPTPSET 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 114/310 (37%)
AT4G31860NP_194914.1 PP2Cc 23..329 CDD:238083 114/309 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 1 1.010 - - D957254at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1200
orthoMCL 1 0.900 - - OOG6_100270
Panther 1 1.100 - - O PTHR13832
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1847
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.