DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and TAP38

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_194509.1 Gene:TAP38 / 828893 AraportID:AT4G27800 Length:388 Species:Arabidopsis thaliana


Alignment Length:302 Identity:96/302 - (31%)
Similarity:154/302 - (50%) Gaps:50/302 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RVGSSCMQGWRVDMEDAHTHILSLPDDPQA-AFFAVYDGHGGASVAKYAGKHLHK---------F 77
            |.|.:.:||:|.:|||   .|:...|...: ::.||:|||.|:|..|:..:.|:|         .
plant    59 RWGYTSVQGFRDEMED---DIVIRSDAVDSFSYAAVFDGHAGSSSVKFLREELYKECVGALQAGS 120

  Fly    78 ITKRPEYRDNSIEVALKKAFLDFDREMLQ----NGSLDEQTAGCTAIVVLIRERRLYCANAGDSR 138
            :....::.  :|:.||.|||...||.:|:    ||. :|..:|.||.|::||....:.|:.|||.
plant   121 LLNGGDFA--AIKEALIKAFESVDRNLLKWLEANGD-EEDESGSTATVMIIRNDVSFIAHIGDSC 182

  Fly   139 AIACISGMVHALSVDHKPNDA-----KESKRIMASGGWVEFNRVNGNLALSRALGD--FIYKKN- 195
            |:...||.:..|:..|:|..:     :|.||:..:|||:...|:.|::|:|||.||  |..||| 
plant   183 AVLSRSGQIEELTDYHRPYGSSRAAIQEVKRVKEAGGWIVNGRICGDIAVSRAFGDIRFKTKKND 247

  Fly   196 -LLKTPEE---------------QIVTAYPDVEVLDITEDLEFVLLACDGIWDVMSNFEVCQFVH 244
             |.|..:|               .:|.|.||:..:.:|.|:||::||.||:||.|.:.:|..:|.
plant   248 MLKKGVDEGRWSEKFVSRIEFKGDMVVATPDIFQVPLTSDVEFIILASDGLWDYMKSSDVVSYVR 312

  Fly   245 KRIRDGMEPELICEELMNSCLSPDGHTGNVGGDNMTVILVCL 286
            .::|.....:|.||.|....|.....      ||:::|:..|
plant   313 DQLRKHGNVQLACESLAQVALDRRSQ------DNISIIIADL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 95/300 (32%)
TAP38NP_194509.1 PP2Cc 58..348 CDD:238083 95/300 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.