DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and PP2CG1

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_180926.1 Gene:PP2CG1 / 817935 AraportID:AT2G33700 Length:380 Species:Arabidopsis thaliana


Alignment Length:284 Identity:102/284 - (35%)
Similarity:146/284 - (51%) Gaps:43/284 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YRVGSSCMQGWRVDMEDAHTHILSLPDDPQA--------AFFAVYDGHGGASVAKYAGKHLHKFI 78
            ||.||...||.:..|||.|..|..|.:...|        ||:.|:|||||...|.:..|::.:||
plant    83 YRSGSCAEQGAKQFMEDEHICIDDLVNHLGAAIQCSSLGAFYGVFDGHGGTDAAHFVRKNILRFI 147

  Fly    79 TKRPEYRDNS----IEVALKKAFLDFDREMLQNGSLDEQTAGCTAIVVLIRERRLYCANAGDSRA 139
            .:     |:|    ::.|:|.|||..|.|...:.||| .::|.||:...|..|||..|||||.||
plant   148 VE-----DSSFPLCVKKAIKSAFLKADYEFADDSSLD-ISSGTTALTAFIFGRRLIIANAGDCRA 206

  Fly   140 IACISGMVHALSVDHKPNDAKESKRIMASGGWVEFNRVNGNLALSRALGDFIYKKNLLKTPEEQI 204
            :....|....||.|||||...|..||...||.|....:||.|:::||:||:     .:|.|:...
plant   207 VLGRRGRAIELSKDHKPNCTAEKVRIEKLGGVVYDGYLNGQLSVARAIGDW-----HMKGPKGSA 266

  Fly   205 --VTAYPDVEVLDITEDLEFVLLACDGIWDVMSNFEVCQFVHKRIRDGMEPELICEELM------ 261
              ::..|:::..|::||.||:::.|||:|||||:........|.:....:||....||:      
plant   267 CPLSPEPELQETDLSEDDEFLIMGCDGLWDVMSSQCAVTIARKELMIHNDPERCSRELVREALKR 331

  Fly   262 NSCLSPDGHTGNVGGDNMTVILVC 285
            |:|            ||:|||:||
plant   332 NTC------------DNLTVIVVC 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 102/284 (36%)
PP2CG1NP_180926.1 PP2C_C 74..378 CDD:421906 102/284 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D957254at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.