DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and DBP1

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001324148.1 Gene:DBP1 / 817102 AraportID:AT2G25620 Length:392 Species:Arabidopsis thaliana


Alignment Length:296 Identity:98/296 - (33%)
Similarity:151/296 - (51%) Gaps:20/296 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GWRVDMEDAHTHILSLPDD--------PQAAFFAVYDGHGGASVAKYAGKHLHKFITKRPEYRDN 87
            |.|..||||:..:.:..|.        ..:||:.|:|||||...|::|..|:.::|.:..|: .:
plant    97 GSRSSMEDAYLCVDNFMDSFGLLNSEAGPSAFYGVFDGHGGKHAAEFACHHIPRYIVEDQEF-PS 160

  Fly    88 SIEVALKKAFLDFDREMLQNGSLDEQTA-GCTAIVVLIRERRLYCANAGDSRAIACISGMVHALS 151
            .|...|..|||..|...|:..|||...| |.||:..::..|.|..|||||.||:....|....:|
plant   161 EINKVLSSAFLQTDTAFLEACSLDGSLASGTTALAAILFGRSLVVANAGDCRAVLSRQGKAIEMS 225

  Fly   152 VDHKPNDAKESKRIMASGGWVEFNRVNGNLALSRALGDFIYKKNLLKTPEEQ---IVTAYPDVEV 213
            .||||..:||.:||.||||.|....:||.|.::|||||| :.:.:.|..:..   .:.|.|::..
plant   226 RDHKPMSSKERRRIEASGGHVFDGYLNGQLNVARALGDF-HMEGMKKKKDGSDCGPLIAEPELMT 289

  Fly   214 LDITEDLEFVLLACDGIWDVMSNFEVCQFVHKRIRDGMEPELICEELMNSCLSPDGHTGNVGGDN 278
            ..:||:.||:::.|||:|||..:.....|..:|:::..:|.:..:||:...|.      ....||
plant   290 TKLTEEDEFLIIGCDGVWDVFMSQNAVDFARRRLQEHNDPVMCSKELVEEALK------RKSADN 348

  Fly   279 MTVILVCLLHNKSYEDLAVRCGGKRKTPVETVGDIQ 314
            :|.::|||........:|.|....|....|.:.|:|
plant   349 VTAVVVCLQPQPPPNLVAPRLRVHRSFSAEGLKDLQ 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 90/266 (34%)
DBP1NP_001324148.1 PLN03145 3..392 CDD:215603 98/296 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D957254at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.