DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and AT2G25070

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001324497.1 Gene:AT2G25070 / 817045 AraportID:AT2G25070 Length:355 Species:Arabidopsis thaliana


Alignment Length:356 Identity:130/356 - (36%)
Similarity:192/356 - (53%) Gaps:66/356 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGQTLSEPVTTKDTACCANASYRVGSSCMQGWRVDMEDAHTHILSLPDDPQAAFFAVYDGHGGAS 65
            ||..||.|.|.|.:....|...|.|.|.|||||..|||||..||.|  |.:.:||.|||||||..
plant     1 MGTYLSSPKTEKLSEDGENDKLRFGLSSMQGWRATMEDAHAAILDL--DDKTSFFGVYDGHGGKV 63

  Fly    66 VAKYAGKHLHKFITKRPEYRDNSIEVALKKAFLDFDREMLQ------------------------ 106
            |||:..|:||:.:.....|:...:|.:|::||...| :|:|                        
plant    64 VAKFCAKYLHQQVISNEAYKTGDVETSLRRAFFRMD-DMMQGQRGWRELAVLGDKMNKFSGMIEG 127

  Fly   107 ------NGSLDEQ-----------------TAGCTAIVVLIRERRLYCANAGDSRAIACISGMVH 148
                  :|..:.|                 |:||||.|.||::::|:.|||||||.:.......:
plant   128 FIWSPRSGDTNNQPDSWPLEDGPHSDFTGPTSGCTACVALIKDKKLFVANAGDSRCVISRKSQAY 192

  Fly   149 ALSVDHKPNDAKESKRIMASGGWVEFNRVNGNLALSRALGDFIYKKNLLKTPEEQIVTAYPDVEV 213
            .||.||||:...|.:||:.:||::...|:||:|.|:||:||..:|:|.....|:|:|||.||:..
plant   193 NLSKDHKPDLEVEKERILKAGGFIHAGRINGSLNLTRAIGDMEFKQNKFLPSEKQMVTADPDINT 257

  Fly   214 LDITEDLEFVLLACDGIWDVMSNFEVCQFVHKRIRDGMEPELICEELMNSCLSPDGHTGNVGGDN 278
            :|:.:|.:|:::|||||||.||:.|:..|:|::::...:...:||::::.||:||..||. |.||
plant   258 IDLCDDDDFLVVACDGIWDCMSSQELVDFIHEQLKSETKLSTVCEKVVDRCLAPDTATGE-GCDN 321

  Fly   279 MTVILVCLLHNKSYEDLAVRCGGKRKTPVET 309
            ||:|||..               |:..|.||
plant   322 MTIILVQF---------------KKPNPSET 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 118/310 (38%)
AT2G25070NP_001324497.1 PP2Cc 14..327 CDD:214625 117/316 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 1 1.010 - - D957254at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1200
orthoMCL 1 0.900 - - OOG6_100270
Panther 1 1.100 - - O PTHR13832
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1847
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.