DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and ILKAP

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_110395.1 Gene:ILKAP / 80895 HGNCID:15566 Length:392 Species:Homo sapiens


Alignment Length:292 Identity:95/292 - (32%)
Similarity:141/292 - (48%) Gaps:47/292 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QGWRVDMEDAHTHILSLPDD--------PQAAFFAVYDGHGGASVAKYAGKHLHK-FITKRPEYR 85
            :|.|.:|:|||..:..:.::        .:.::|||:|||||...:|:|.::||: .|.|.|:..
Human   115 KGEREEMQDAHVILNDITEECRPPSSLITRVSYFAVFDGHGGIRASKFAAQNLHQNLIRKFPKGD 179

  Fly    86 DNSIEVALKKAFLD----FDREMLQNGSLDEQT--AGCTAIVVLIRERRLYCANAGDSRAIAC-- 142
            ..|:|..:|:..||    .|.|.|:..|..:..  .|.||..||..:..||.||.||||||.|  
Human   180 VISVEKTVKRCLLDTFKHTDEEFLKQASSQKPAWKDGSTATCVLAVDNILYIANLGDSRAILCRY 244

  Fly   143 -ISGMVHA---LSVDHKPNDAKESKRIMASGGWVEFNRVNGNLALSRALGDFIYKKNLLKTPEEQ 203
             .....||   ||.:|.|...:|..||..:||.|...||.|.|.:||::||..||:        .
Human   245 NEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRDGRVLGVLEVSRSIGDGQYKR--------C 301

  Fly   204 IVTAYPDVEVLDITEDLEFVLLACDGIWDVMSNFEVCQFVHK-------RIRDGMEP-----ELI 256
            .||:.||:....:|.:..|:||||||::.|.:..|...|:..       :.|:|...     |..
Human   302 GVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDEKIQTREGKSAADARYEAA 366

  Fly   257 CEELMNSCLSPDGHTGNVGGDNMTVILVCLLH 288
            |..|.|..:.      ....||:||::|.:.|
Human   367 CNRLANKAVQ------RGSADNVTVMVVRIGH 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 94/288 (33%)
ILKAPNP_110395.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90
PP2Cc 108..390 CDD:238083 94/288 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2442
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.