DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and ppm1lb

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001307112.1 Gene:ppm1lb / 767640 ZFINID:ZDB-GENE-060929-136 Length:348 Species:Danio rerio


Alignment Length:273 Identity:94/273 - (34%)
Similarity:141/273 - (51%) Gaps:38/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 MQGWRVDMEDAHTHILSLPDDPQAAFFAVYDGHGGASVAKYAGKH----LHKFITKRPEYRDNSI 89
            :||.|..|||....:....:....|.|::||||||.:.|:||..|    |.:.:.:....::||.
Zfish    87 IQGRRDHMEDRFDILTDTRNRSHPAIFSIYDGHGGEAAAEYAKAHLPIMLRQQLQRYERQKENSA 151

  Fly    90 ---EVALKKAFLDFDREMLQNGSLDEQTAGCTAIVVLIRERRLYCANAGDSRAIAC-ISGMVHAL 150
               :..|::..|:.|||:|:..:.....||.|.:|.|:.|:.|..||.|||||:.| ..|....|
Zfish   152 VSRQAILRQQILNMDREILEKLTASYDEAGTTCLVALLSEKELTVANVGDSRAVLCDKDGNAIPL 216

  Fly   151 SVDHKPNDAKESKRIMASGGWVEFN---RVNGNLALSRALGDFIYKKNLLKTPEEQIVTAYPDVE 212
            |.||||...||.|||..:||::.|:   ||.|.|::||:||||..||..:..|:       ||:.
Zfish   217 SHDHKPYQLKERKRIKKAGGFISFSGSWRVQGVLSMSRSLGDFPLKKLKVLIPD-------PDLM 274

  Fly   213 VLDI-TEDLEFVLLACDGIWDVMSNFEVCQFVHKRIRDGMEP-----ELICEELMNSCLSPDGHT 271
            ..|: |...:|::||.||:||..||.|...|:.:|:.   ||     .::.:.....|       
Zfish   275 TFDLDTLQPQFMILASDGLWDTFSNEEAVHFIKERLD---EPHFGAKSIVLQSFYRGC------- 329

  Fly   272 GNVGGDNMTVILV 284
                .||:||::|
Zfish   330 ----PDNITVMVV 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 94/273 (34%)
ppm1lbNP_001307112.1 PP2Cc 82..340 CDD:238083 94/273 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.