DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and Ppm1f

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_789803.1 Gene:Ppm1f / 68606 MGIID:1918464 Length:452 Species:Mus musculus


Alignment Length:346 Identity:116/346 - (33%)
Similarity:152/346 - (43%) Gaps:58/346 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TACCANASYRVGSSCMQGWRVDMEDAH------THILSLPDDPQAAFFAVYDGHGGASVAKYAGK 72
            ||......:.|....::..|..|||.|      .|:..|.|....|:|||:|||||...|:||..
Mouse   144 TAQAPQWQWLVSIHAIRNTRRKMEDRHVSLPAFNHLFGLSDSVHRAYFAVFDGHGGVDAARYASV 208

  Fly    73 HLHKFITKRPEYRDNSIEVALKKAFLDFDREMLQNGSLDEQTAGCTAIVVLIRERRLYCANAGDS 137
            |:|...:.:||.|.|. ..|||:||...|...||....:...:|.|.:..||....|:.|..|||
Mouse   209 HVHTNASHQPELRTNP-AAALKEAFRLTDEMFLQKAKRERLQSGTTGVCALIAGAALHVAWLGDS 272

  Fly   138 RAIACISGMVHALSVDHKPNDAKESKRIMASGGWVEFN---RVNGNLALSRALGDFIYKKNLLKT 199
            :.|....|.|..|...|||....|..||.|.||:|...   ||||.||:|||:||...|      
Mouse   273 QVILVQQGRVVKLMEPHKPERQDEKARIEALGGFVSLMDCWRVNGTLAVSRAIGDVFQK------ 331

  Fly   200 PEEQIVTAYPDVEVLDITEDLEFVLLACDGIWDVMSNFEVCQFVHKRI----RDGMEPELICEEL 260
               ..|:...|....::|...:::||||||.:||:.:.||...||..:    .:||.   |.|||
Mouse   332 ---PYVSGEADAASRELTGSEDYLLLACDGFFDVVPHHEVTGLVHGHLLRHKGNGMR---IAEEL 390

  Fly   261 MNSCLSPDGHTGNVGGDNMTVILVCLLHNKSYEDLAVRCGGKRKTPVETVGDIQDQSVKVVTPCS 325
            :........|      ||:||::|.|     .|.|.:..||     |:..||.|         ..
Mouse   391 VAVARDRGSH------DNITVMVVFL-----REPLELLEGG-----VQGTGDAQ---------AD 430

  Fly   326 QGSSGSSTSRLGLGFGLRESE 346
            .||...||       ||.|.|
Mouse   431 VGSQDLST-------GLSELE 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 97/276 (35%)
Ppm1fNP_789803.1 PP2C 152..403 CDD:366121 93/269 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834860
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R955
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.