Sequence 1: | NP_612039.1 | Gene: | Ppm1 / 38071 | FlyBaseID: | FBgn0035143 | Length: | 352 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001316857.1 | Gene: | PDP2 / 57546 | HGNCID: | 30263 | Length: | 529 | Species: | Homo sapiens |
Alignment Length: | 291 | Identity: | 71/291 - (24%) |
---|---|---|---|
Similarity: | 108/291 - (37%) | Gaps: | 102/291 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 55 FAVYDGHGGASVAKYAGKHLHKFIT-----------------------------KRPE---YRD- 86
Fly 87 -----------------------NSIEVALKKAF--LDFD----------REMLQNGSLDEQTAG 116
Fly 117 CTAIVVLIRERRLYCANAGDSRAIACI---SGMVHALSV--DHKPNDAKESKRIMASGGWVE--- 173
Fly 174 ---FNRVNGNLALSRALGDFIYK------KNLLK-------------TPEE----QIVTAYPDVE 212
Fly 213 VLDITEDLEFVLLACDGIWDVMSNFEVCQFV 243 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ppm1 | NP_612039.1 | PP2Cc | 22..286 | CDD:238083 | 71/291 (24%) |
PDP2 | NP_001316857.1 | PP2Cc | 109..517 | CDD:238083 | 71/291 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165144752 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0631 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |