DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and PDP2

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001316857.1 Gene:PDP2 / 57546 HGNCID:30263 Length:529 Species:Homo sapiens


Alignment Length:291 Identity:71/291 - (24%)
Similarity:108/291 - (37%) Gaps:102/291 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 FAVYDGHGGASVAKYAGKHLHKFIT-----------------------------KRPE---YRD- 86
            |.::|||||.:.|:...:.|..::.                             |.|.   |:| 
Human   137 FGIFDGHGGHACAQAVSERLFYYVAVSLMSHQTLEHMEGAMESMKPLLPILHWLKHPGDSIYKDV 201

  Fly    87 -----------------------NSIEVALKKAF--LDFD----------REMLQNGSLDEQTAG 116
                                   .|||.||..:|  ||.|          .|:.:|.||....:|
Human   202 TSVHLDHLRVYWQELLDLHMEMGLSIEEALMYSFQRLDSDISLEIQAPLEDEVTRNLSLQVAFSG 266

  Fly   117 CTAIVVLIRERRLYCANAGDSRAIACI---SGMVHALSV--DHKPNDAKESKRIMASGGWVE--- 173
            .||.:..:....|:.|||||.|||..:   :||...|.:  ||...:..|..|:.......|   
Human   267 ATACMAHVDGIHLHVANAGDCRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRT 331

  Fly   174 ---FNRVNGNLALSRALGDFIYK------KNLLK-------------TPEE----QIVTAYPDVE 212
               .:|:.|.|...||.||...|      :::|:             ||..    ..:||.|:|.
Human   332 IIMEDRLLGVLIPCRAFGDVQLKWSKELQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVT 396

  Fly   213 VLDITEDLEFVLLACDGIWDVMSNFEVCQFV 243
            ...:....:|::||.||:||::||.:|.:.|
Human   397 YHRLRPQDKFLVLASDGLWDMLSNEDVVRLV 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 71/291 (24%)
PDP2NP_001316857.1 PP2Cc 109..517 CDD:238083 71/291 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144752
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.