DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and PPM1H

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_065751.1 Gene:PPM1H / 57460 HGNCID:18583 Length:514 Species:Homo sapiens


Alignment Length:370 Identity:77/370 - (20%)
Similarity:142/370 - (38%) Gaps:136/370 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 FFAVYDGHGGASVAKYAGKHLHKFITKR----------------------PE------------- 83
            :::::|||.|:..|..|.:.|...||::                      ||             
Human   146 YWSLFDGHAGSGAAVVASRLLQHHITEQLQDIVDILKNSAVLPPTCLGEEPENTPANSRTLTRAA 210

  Fly    84 -------------------YRDNSIE------VALKKAFLDFDREMLQNGSLDEQTAGCTAIVVL 123
                               :.:..|.      .||:.||.:.|.::.:..|....:.||||::|:
Human   211 SLRGGVGAPGSPSTPPTRFFTEKKIPHECLVIGALESAFKEMDLQIERERSSYNISGGCTALIVI 275

  Fly   124 IRERRLYCANAGDSRAIACISGMVHALSVDHKPNDAKESKRIMA--------------------- 167
            ....:||.|||||||||...:|.:..:|.:..|...::..:.:|                     
Human   276 CLLGKLYVANAGDSRAIIIRNGEIIPMSSEFTPETERQRLQYLAFMQPHLLGNEFTHLEFPRRVQ 340

  Fly   168 --------------SGGW---------VEF---------NRVNGNLALSRALGDF---IYKKNLL 197
                          ..||         ::|         .||...:.::|.|||.   ::..|:.
Human   341 RKELGKKMLYRDFNMTGWAYKTIEDEDLKFPLIYGEGKKARVMATIGVTRGLGDHDLKVHDSNIY 405

  Fly   198 KTPEEQIVTAYPDVEVLDITE----DLEFVLLACDGIWDVMSNFEVCQFVHKRIR--DGMEPE-- 254
            ..|   .:::.|:|.:.|:::    ..:.::||.||:|||:||.||.:.:.:.:.  |..:|.  
Human   406 IKP---FLSSAPEVRIYDLSKYDHGSDDVLILATDGLWDVLSNEEVAEAITQFLPNCDPDDPHRY 467

  Fly   255 -LICEELM---NSCLSPDG---HTGNVG-GDNMTVILVCLLH-NK 290
             |..::|:   ...|...|   ....:| ||:::|.::.|:| ||
Human   468 TLAAQDLVMRARGVLKDRGWRISNDRLGSGDDISVYVIPLIHGNK 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 73/363 (20%)
PPM1HNP_065751.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..135
PP2Cc 143..507 CDD:238083 73/363 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144731
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.