DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and pptc7b

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_009303413.1 Gene:pptc7b / 562909 ZFINID:ZDB-GENE-081105-111 Length:297 Species:Danio rerio


Alignment Length:234 Identity:53/234 - (22%)
Similarity:85/234 - (36%) Gaps:89/234 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DDPQAAFFA---------VYDGHGG------------ASVAKYAGKHLHKFITKRPEYRDNSIEV 91
            ||  |.|.|         |.||.||            |::.|...:     :.|...:..:|...
Zfish    53 DD--ACFIARHKSADVLGVADGVGGWRDYGVDPSQFSATLMKTCER-----LVKEGRFTPSSPVG 110

  Fly    92 ALKKAFLDFDREMLQN-----GSLDEQTAGCTAIVVLI--RERRLYCANAGDSRAIACISGMVHA 149
            .|...:.    |:|||     ||       .||.:|::  |..|::..|.|||..:....|    
Zfish   111 ILTSGYY----ELLQNKVPLLGS-------STACIVVLDRRSHRIHTCNLGDSGFLVVRGG---- 160

  Fly   150 LSVDHKPNDAKESKRIMASGGWVEFNRVNGNLALSRA--------LGDFIYKKNLLKTPEEQIVT 206
             .|.|:.::.:              :..|....||.|        |.|         :||....:
Zfish   161 -EVVHRSDEQQ--------------HYFNTPFQLSIAPPGAEGVVLSD---------SPEAADSS 201

  Fly   207 AYPDVEVLDITEDLEFVLLACDGIWDVMSNFEVCQFVHK 245
            :: ||::.||      :|.|.||::|.|.::.:.|.:.|
Zfish   202 SF-DVQLGDI------ILTATDGLFDNMPDYMILQELKK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 53/234 (23%)
pptc7bXP_009303413.1 PP2Cc 53..289 CDD:294085 53/234 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.