DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and ppm1la

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001071068.1 Gene:ppm1la / 556994 ZFINID:ZDB-GENE-061103-118 Length:361 Species:Danio rerio


Alignment Length:273 Identity:96/273 - (35%)
Similarity:140/273 - (51%) Gaps:38/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 MQGWRVDMEDAHTHILSLPDDPQAAFFAVYDGHGGASVAKYAGKHLHKFITKR-----PEYRDN- 87
            :||.|..|||....:..|.:....:.||::|||||...|.|...||.:.:.::     .|.:|: 
Zfish    98 IQGRRDHMEDRFEVLTDLANRSHPSIFAIFDGHGGEGAADYVKAHLPEALKQQLQAFEREKKDSP 162

  Fly    88 -SIEVALKKAFLDFDREMLQNGSLDEQTAGCTAIVVLIRERRLYCANAGDSRAIAC-ISGMVHAL 150
             |....|::..|..||:|::..|.....||.|.::.|:.:|.|..||.||||.:.| ..|...||
Zfish   163 LSYPSILEQRILAVDRDMVEKFSASHDEAGTTCLIALLSDRELTVANVGDSRGVLCDKDGNAVAL 227

  Fly   151 SVDHKPNDAKESKRIMASGGWVEFN---RVNGNLALSRALGDFIYKKNLLKTPEEQIVTAYPDVE 212
            |.||||...||.|||..:||::.||   ||.|.||:||:|||:.. |||      .:|...||:.
Zfish   228 SHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPL-KNL------NVVIPDPDIL 285

  Fly   213 VLDITE-DLEFVLLACDGIWDVMSNFEVCQFVHKRIRDGMEP-----ELICEELMNSCLSPDGHT 271
            ..|:.: ..||::||.||:||..||.|..:||.:|:.   ||     .::.:.....|       
Zfish   286 TFDLDKLQPEFMILASDGLWDAFSNEEAVRFVRERLD---EPHFGAKSIVLQSFYRGC------- 340

  Fly   272 GNVGGDNMTVILV 284
                .||:||::|
Zfish   341 ----PDNITVMVV 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 96/273 (35%)
ppm1laNP_001071068.1 PP2Cc 93..351 CDD:238083 96/273 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.