DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and ppm1a

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001016158.2 Gene:ppm1a / 548912 XenbaseID:XB-GENE-852654 Length:383 Species:Xenopus tropicalis


Alignment Length:296 Identity:125/296 - (42%)
Similarity:172/296 - (58%) Gaps:17/296 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGQTLSEPVTTKDTACCANASYRVGSSCMQGWRVDMEDAHTHILSLPDDPQA-AFFAVYDGHGGA 64
            ||..|.:|...|..|.......|.|.|.||||||:||||||.::.||:...| :||||||||.|:
 Frog     1 MGAFLDKPKMEKHNAHGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPNGLDAWSFFAVYDGHAGS 65

  Fly    65 SVAKYAGKHLHKFITKRPEYRDN-------SIEVALKKAFLDFDREM--LQNGSLDEQTAGCTAI 120
            .||||..:||...||...:::..       |::..::..||..|..|  :.........:|.||:
 Frog    66 QVAKYCCEHLLDHITSNQDFKGTDGHLSVWSVKNGIRTGFLQIDEHMRVISEKKHGADRSGSTAV 130

  Fly   121 VVLIRERRLYCANAGDSRAIACISGMVHALSVDHKPNDAKESKRIMASGGWVEFNRVNGNLALSR 185
            .|:.....:|..|.||||.:.|.|..||..:.||||::..|.:||..:||.|...||||:||:||
 Frog   131 GVMTSPNHIYFINCGDSRGLLCRSKKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSR 195

  Fly   186 ALGDFIYKKNLLKTPEEQIVTAYPDV-EVLDITEDLEFVLLACDGIWDVMSNFEVCQFVHKRIRD 249
            |||||.||....|.|.||:|:..|:| |:....||.:|::||||||||||.|.|:|.||..|:..
 Frog   196 ALGDFDYKCVHGKGPTEQLVSPEPEVYEIERSEEDDQFIILACDGIWDVMGNEELCDFVWSRLEV 260

  Fly   250 GMEPELICEELMNSCLSPDGHTGNVGGDNMTVILVC 285
            ..:.|.:|.|::::||    :.|:  .|||:|||:|
 Frog   261 TDDLERVCNEIVDTCL----YKGS--RDNMSVILIC 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 119/275 (43%)
ppm1aNP_001016158.2 PP2C 22..284 CDD:366121 113/267 (42%)
PP2C_C 285..361 CDD:369544 4/6 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D262211at33208
OrthoFinder 1 1.000 - - FOG0000692
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R955
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.