DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and Pdp1

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_006237970.1 Gene:Pdp1 / 54705 RGDID:620393 Length:578 Species:Rattus norvegicus


Alignment Length:338 Identity:68/338 - (20%)
Similarity:113/338 - (33%) Gaps:135/338 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ANA---SYRVGSSCMQGWRVDMEDAHTHILSLPDDPQAAFFAVYDGHGGASVAKYAGKHLHKFIT 79
            |||   ..|..::|:|                   .:.....|:|||.|.:.::...:.|..:|.
  Rat   159 ANAPIEDRRSAATCLQ-------------------TRGMLLGVFDGHAGCACSQAVSERLFYYIA 204

  Fly    80 -----------------------------KRP-----------------------------EYRD 86
                                         |.|                             |..|
  Rat   205 VSLLPHETLLEIENAVESGRALLPILQWHKHPNDYFSKEASKLYFNSLRTYWQELIDLNTGESAD 269

  Fly    87 NSIEVALKKAFLDFDREMLQNGSLDEQT----------------AGCTAIVVLIRERRLYCANAG 135
            ..::.||..||...|.::    ||:.|.                :|.||.|..:....|:.||.|
  Rat   270 IDVKEALINAFKRLDNDI----SLEAQVGDPNSFLNYLVLRVAFSGATACVAHVDGVDLHVANTG 330

  Fly   136 DSRAIACI-----SGMVHALSVDHKPNDAKESKRIM------ASGGWVEFNRVNGNLALSRALGD 189
            ||||:..:     |.....||.||...:.:|.:|:.      .:...|:.:|:.|.|...||.||
  Rat   331 DSRAMLGVQEEDGSWSAVTLSNDHNAQNERELERLKLEHPKNEAKSVVKQDRLLGLLMPFRAFGD 395

  Fly   190 FIYK------KNLLKTPEEQI------------------VTAYPDVEVLDITEDLEFVLLACDGI 230
            ..:|      |.::::..:|:                  :||.|:|....:....:|::||.||:
  Rat   396 VKFKWSIDLQKRVIESGPDQLNDNEYTKFIPPNYHTPPYLTAEPEVTYHRLRPQDKFLVLATDGL 460

  Fly   231 WDVMSNFEVCQFV 243
            |:.|...:|.:.|
  Rat   461 WETMHRQDVVRIV 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 65/331 (20%)
Pdp1XP_006237970.1 PP2Cc 149..565 CDD:238083 68/338 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.