DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and PDP1

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_016869077.1 Gene:PDP1 / 54704 HGNCID:9279 Length:591 Species:Homo sapiens


Alignment Length:338 Identity:68/338 - (20%)
Similarity:113/338 - (33%) Gaps:135/338 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ANA---SYRVGSSCMQGWRVDMEDAHTHILSLPDDPQAAFFAVYDGHGGASVAKYAGKHLHKFIT 79
            |||   ..|..::|:|                   .:.....|:|||.|.:.::...:.|..:|.
Human   173 ANAPIEDRRSAATCLQ-------------------TRGMLLGVFDGHAGCACSQAVSERLFYYIA 218

  Fly    80 -----------------------------KRP-----------------------------EYRD 86
                                         |.|                             |..|
Human   219 VSLLPHETLLEIENAVESGRALLPILQWHKHPNDYFSKEASKLYFNSLRTYWQELIDLNTGESTD 283

  Fly    87 NSIEVALKKAFLDFDREMLQNGSLDEQT----------------AGCTAIVVLIRERRLYCANAG 135
            ..::.||..||...|.::    ||:.|.                :|.||.|..:....|:.||.|
Human   284 IDVKEALINAFKRLDNDI----SLEAQVGDPNSFLNYLVLRVAFSGATACVAHVDGVDLHVANTG 344

  Fly   136 DSRAIACI-----SGMVHALSVDHKPNDAKESKRI------MASGGWVEFNRVNGNLALSRALGD 189
            ||||:..:     |.....||.||...:.:|.:|:      ..:...|:.:|:.|.|...||.||
Human   345 DSRAMLGVQEEDGSWSAVTLSNDHNAQNERELERLKLEHPKSEAKSVVKQDRLLGLLMPFRAFGD 409

  Fly   190 FIYK------KNLLKTPEEQI------------------VTAYPDVEVLDITEDLEFVLLACDGI 230
            ..:|      |.::::..:|:                  :||.|:|....:....:|::||.||:
Human   410 VKFKWSIDLQKRVIESGPDQLNDNEYTKFIPPNYHTPPYLTAEPEVTYHRLRPQDKFLVLATDGL 474

  Fly   231 WDVMSNFEVCQFV 243
            |:.|...:|.:.|
Human   475 WETMHRQDVVRIV 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 65/331 (20%)
PDP1XP_016869077.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.