DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and ppm1b

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_012818372.1 Gene:ppm1b / 493392 XenbaseID:XB-GENE-999170 Length:455 Species:Xenopus tropicalis


Alignment Length:319 Identity:132/319 - (41%)
Similarity:186/319 - (58%) Gaps:33/319 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGQTLSEPVTTKDTACCANASYRVGSSCMQGWRVDMEDAHTHILSLP---DDPQAAFFAVYDGHG 62
            ||..|.:|.|.|..|..|....|.|.|.||||||:||||||.::.:|   ||  .:||||||||.
 Frog     1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPRGLDD--WSFFAVYDGHA 63

  Fly    63 GASVAKYAGKHLHKFITKRPEYRD------------NSIEVALKKAFLDFDREM-----LQNGSL 110
            |:.||.|...||.:.||...::|.            .:::..::..||..|..|     |:|| :
 Frog    64 GSRVANYCSSHLLEHITDNEDFRATETPGSALEPTVENVKSGIRTGFLKIDEYMRNFADLRNG-M 127

  Fly   111 DEQTAGCTAIVVLIRERRLYCANAGDSRAIACISGMVHALSVDHKPNDAKESKRIMASGGWVEFN 175
            |.  :|.||:.||:....:|..|.|||||:...||.|...:.||||.:.:|.:||..:||.|...
 Frog   128 DR--SGSTAVAVLLSPSHVYFINCGDSRAVLYRSGQVCFSTQDHKPCNPREKERIQNAGGSVMIQ 190

  Fly   176 RVNGNLALSRALGDFIYKKNLLKTPEEQIVTAYPDV-EVLDITEDLEFVLLACDGIWDVMSNFEV 239
            ||||:||:||||||:.||....|.|.||:|:..|:| |::...|| ||::||||||||||||.|:
 Frog   191 RVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVRADED-EFIILACDGIWDVMSNEEL 254

  Fly   240 CQFVHKRIRDGMEPELICEELMNSCLSPDGHTGNVGGDNMTVILVCLLHNKSYEDLAVR 298
            |:||..|:....:.|.:|..::::||    |.|:  .|||:::|||..:.....:.|::
 Frog   255 CEFVKYRLELTDDLEKVCNSVVDTCL----HKGS--RDNMSIVLVCFPNAPKVSEEAIK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 122/284 (43%)
ppm1bXP_012818372.1 PP2Cc 23..295 CDD:238083 122/283 (43%)
PP2C_C 289..365 CDD:369544 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 1 1.010 - - D262211at33208
OrthoFinder 1 1.000 - - FOG0000692
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R955
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.