DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and fig

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_651724.1 Gene:fig / 43511 FlyBaseID:FBgn0039694 Length:314 Species:Drosophila melanogaster


Alignment Length:298 Identity:60/298 - (20%)
Similarity:84/298 - (28%) Gaps:122/298 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PQAAFFAVYDGHGGASVAKYAGKHLHKFITKRPEYRDNSIEVA-LKKAFL----------DFD-- 101
            |.|....|.||.||                    :||..::.. ..|..:          |||  
  Fly    78 PLAEVMGVADGVGG--------------------WRDLGVDAGRFAKELMSCCSGQTQLSDFDGR 122

  Fly   102 --REMLQNG-----SLDEQTAGCTAIVVLIRERR---LYCANAGDSRAIACISGMVHALSVDHKP 156
              |.||..|     ..:....|.:...:....|:   ||.||.|||..:...:|.|...||:.  
  Fly   123 SPRNMLIAGFQELSHREHPVVGSSTACLATMHRKDCTLYTANLGDSGFLVVRNGRVLHRSVEQ-- 185

  Fly   157 NDAKESKRIMASGGWVEFNRVNGNLALSRALGDFIYKKNLLKTPEEQIVTAYPDVEVLDITE--- 218
                                          ..||.....|...||::..:.|.|...:.::.   
  Fly   186 ------------------------------THDFNTPYQLTVPPEDRKESYYCDKPEMAVSTRHS 220

  Fly   219 ----DLEFVLLACDGIWDVMSNFEVCQFVHKRIRDGMEPELICEELMNSCLSPDGHTGNVGGDNM 279
                ||  ||||.||::|.|                  ||.:...::|.......|...||...:
  Fly   221 LLPGDL--VLLATDGLFDNM------------------PESMLLSILNGLKERGEHDLLVGASRV 265

  Fly   280 T---------------VILVCLLHNKSYEDLAVRCGGK 302
            .               ..:....||.||..     |||
  Fly   266 VEKARELSMNASFQSPFAIKARQHNVSYSG-----GGK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 53/280 (19%)
figNP_651724.1 PP2Cc 68..306 CDD:294085 60/298 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.