DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and CG6036

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster


Alignment Length:288 Identity:107/288 - (37%)
Similarity:167/288 - (57%) Gaps:11/288 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGQTLSEPVTTKDTACCANASYRVGSSCMQGWRVDMEDAHTHILSLPDDPQA--AFFAVYDGHGG 63
            ||..|.:|.|.|..........|...|.|||||::|||:|:....| .||.|  ::|||:|||.|
  Fly     5 MGGFLEKPETEKQAQEGHGNGLRYCVSSMQGWRLEMEDSHSAACRL-KDPFATWSYFAVFDGHAG 68

  Fly    64 ASVAKYAGKHLHKFITKRPEYRDNSIEVALKKAFLDFDREMLQNGSLDEQTAGCTAIVVLIRERR 128
            :.::.:..:||...|.:...:..:..|..:::.||..|.:|.:  ...:|..|.|||.|.:...:
  Fly    69 SQISLHCAEHLMSTILESESFSKHKYEAGIREGFLQLDEDMRK--LYHDQQGGSTAICVFVSPDK 131

  Fly   129 LYCANAGDSRAIACISGMVHALSVDHKPNDAKESKRIMASGGWVEFNRVNGNLALSRALGDFIYK 193
            :|..|.|||||:...:|.....::||||...||.:||..:||.|...|:||.||:|||.||:.:|
  Fly   132 IYLVNCGDSRAVISRNGAAVISTIDHKPFSPKEQERIQNAGGSVMIKRINGTLAVSRAFGDYDFK 196

  Fly   194 KNLLKTPEEQIVTAYPDVEVLDITEDLEFVLLACDGIWDVMSNFEVCQFVHKRIRDGMEPELICE 258
            .:..|:|.:|:|:..||:.|.:.:|..||:::|||||||||::.|||:|:..|:....:..:|..
  Fly   197 NDGSKSPVDQMVSPEPDIIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFIRSRLLVTYDLPMIVN 261

  Fly   259 ELMNSCLSPDGHTGNVGGDNMTVILVCL 286
            .:::.||    |.|:  .||||::|:.|
  Fly   262 SVLDICL----HKGS--RDNMTLLLLLL 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 100/265 (38%)
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 97/258 (38%)
PP2C_C 284..352 CDD:285117 107/288 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438655
Domainoid 1 1.000 147 1.000 Domainoid score I1447
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D262211at33208
OrthoFinder 1 1.000 - - FOG0000692
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100270
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.