DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and CG12091

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster


Alignment Length:198 Identity:46/198 - (23%)
Similarity:74/198 - (37%) Gaps:65/198 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 GCTAIVVLIRERR---LYCANAGDSRAIACISGMVHALSVDHKPNDAKESKRIMASGGWVEFNRV 177
            |.:...|||..|.   ::.||.|||..:....|     .|.||   ::|.:...           
  Fly   154 GSSTACVLILNRETSTVHTANIGDSGFVVVREG-----QVVHK---SEEQQHYF----------- 199

  Fly   178 NGNLALSRALGDFIYKKNLLK-TPEEQIVTAYPDVEVLDITEDLEFVLLACDGIWD--------- 232
              |.....:|....:..|:|. :||.....::|       ..|.:.:|:|.||::|         
  Fly   200 --NTPFQLSLPPPGHGPNVLSDSPESADTMSFP-------VRDGDVILIATDGVFDNVPEDLMLQ 255

  Fly   233 VMSNFEVCQFVHKRIRDGMEPELICEEL--------MNS-CLSP---DGHTGNV---GG--DNMT 280
            |:|..|       ..||.::.::....|        :|| .|||   .....|:   ||  |::|
  Fly   256 VLSEVE-------GERDPVKLQMTANSLALMARTLSLNSEFLSPFALSARRNNIQARGGKPDDIT 313

  Fly   281 VIL 283
            |:|
  Fly   314 VVL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 46/198 (23%)
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 45/196 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.