DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and CG10376

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster


Alignment Length:267 Identity:75/267 - (28%)
Similarity:118/267 - (44%) Gaps:48/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 DPQAAFFAVYDGHGGASVAKYAGKHLHKFITKR-----------PEYRDNSIEVALKKAFLDFDR 102
            |....||.|:|||.|:..|.||...|.:.:..:           |::..|:.|    .|||..|.
  Fly   190 DKTTRFFGVFDGHSGSLSATYATSQLPQLLADQLKANPDPAAFSPDFYRNAFE----SAFLLADE 250

  Fly   103 EMLQNGSLDEQTAGCTAIVVLIRERRLYCANAGDSRAIACISGMVHALSVDHKPNDAKESKRIMA 167
            ...|.    :.|:|.|::..||.:.:||.|..|||:|:.........|...|||.:..|.|||..
  Fly   251 RFTQK----KITSGTTSVCALITKDQLYIAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRIET 311

  Fly   168 SGG--------WVEFNRVNGNLALSRALGDFIYKKNLLKTPEEQIVTAYPDVEVLDITEDLEFVL 224
            :||        |    ||||.|.::|::||:          ..:.|.|.||...:.:.|..:|::
  Fly   312 AGGTVLHAQGQW----RVNGILNVARSIGDY----------SLEAVIAEPDFVDVQLNEAHDFLV 362

  Fly   225 LACDGIWDVMSNFEVCQFVHKRIRD-GMEPELICEELMNSCLSPDGHTGNVGGDNMTVILVCLLH 288
            |..||:||.:....:.:.|:..:.| .|:.:.|.:.|:.:....|..      ||:|.::|.|..
  Fly   363 LGTDGLWDHVPESLIIETVYDSLADTTMKLDDIPKLLIEAAKERDSQ------DNITAVVVLLKP 421

  Fly   289 NKSYEDL 295
            ....|.|
  Fly   422 RHQIEHL 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 72/256 (28%)
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 72/256 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445091
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13832
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R955
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.